BLASTX nr result
ID: Angelica22_contig00015692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00015692 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512488.1| Guanosine-5'-triphosphate,3'-diphosphate pyr... 57 2e-06 emb|CAP08387.1| Ppx-GppA phosphatase protein (exopolyphosphatase... 55 6e-06 ref|XP_002892489.1| pentatricopeptide repeat-containing protein ... 55 8e-06 >ref|XP_002512488.1| Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase, putative [Ricinus communis] gi|223548449|gb|EEF49940.1| Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase, putative [Ricinus communis] Length = 615 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 154 VFDGYGLNANVRWRSVMQLATRSNNKKRMKCVALCAAIA 38 VF+GY LNAN RWRSV++LATR + KKR+K A CA IA Sbjct: 317 VFEGYDLNANARWRSVVRLATRFSEKKRIKSAAQCATIA 355 >emb|CAP08387.1| Ppx-GppA phosphatase protein (exopolyphosphatase) [Capsicum annuum] Length = 564 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = -3 Query: 151 FDGYGLNANVRWRSVMQLATRSNNKKRMKCVALCAAIAKVCS*EQLNRH 5 FD Y AN RWRS+++L TR NNK+RMK ALC ++AK NRH Sbjct: 338 FDNYDPRANARWRSIVRLGTRFNNKQRMKSAALCFSVAKEMFDGLKNRH 386 >ref|XP_002892489.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338331|gb|EFH68748.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1014 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/41 (70%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -3 Query: 151 FDG-YGLNANVRWRSVMQLATRSNNKKRMKCVALCAAIAKV 32 FDG Y LNAN RWRSVM+LATR N KKRM CA IAKV Sbjct: 327 FDGSYDLNANARWRSVMRLATRFNGKKRMTHAIHCAKIAKV 367