BLASTX nr result
ID: Angelica22_contig00015196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00015196 (1476 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD99221.1| polypepetide with reverse transcriptase and RNas... 59 4e-06 >dbj|BAD99221.1| polypepetide with reverse transcriptase and RNaseH domains [Petunia x hybrida] Length = 389 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/66 (43%), Positives = 40/66 (60%) Frame = -2 Query: 1247 PKKLVAPNPIHLKFQSSDGDLLPNLDVFRSLLGKHNFLVHTRCDLCYSVQA*SQFMQKPS 1068 P+ + P LK S G+LL + +R L+GK N+L HTR D+ ++VQ SQ MQ P Sbjct: 137 PRTVTTPLDPSLKLSSISGELLQDPTFYRRLVGKLNYLTHTRPDISFAVQTLSQHMQSPR 196 Query: 1067 TSHLEA 1050 + HLEA Sbjct: 197 SGHLEA 202