BLASTX nr result
ID: Angelica22_contig00015120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00015120 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73956.1| hypothetical protein VITISV_026134 [Vitis vinifera] 79 3e-13 ref|XP_002515460.1| conserved hypothetical protein [Ricinus comm... 79 4e-13 ref|XP_002305873.1| predicted protein [Populus trichocarpa] gi|2... 78 7e-13 emb|CBI33549.3| unnamed protein product [Vitis vinifera] 77 1e-12 >emb|CAN73956.1| hypothetical protein VITISV_026134 [Vitis vinifera] Length = 389 Score = 79.3 bits (194), Expect = 3e-13 Identities = 38/52 (73%), Positives = 40/52 (76%), Gaps = 2/52 (3%) Frame = +1 Query: 1 QKIRDSNGEFNWKDGENHWENFMKYKEVFGDVELEVKDDSFKGFD--LFGDS 150 QKIR S EFNWKDGENHWENF+KYKEVFGDVELE K+ G D LF DS Sbjct: 81 QKIRVSEDEFNWKDGENHWENFLKYKEVFGDVELEAKEKKLGGDDVGLFDDS 132 >ref|XP_002515460.1| conserved hypothetical protein [Ricinus communis] gi|223545404|gb|EEF46909.1| conserved hypothetical protein [Ricinus communis] Length = 391 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/52 (73%), Positives = 39/52 (75%), Gaps = 3/52 (5%) Frame = +1 Query: 1 QKIRDSNGEFNWKDGENHWENFMKYKEVFGDVELEVKDDSFK---GFDLFGD 147 QKIR S EFNWKDGENHWENF+KYKEVFGDVELEVK G DLF D Sbjct: 81 QKIRISKDEFNWKDGENHWENFLKYKEVFGDVELEVKSKKLSDSCGSDLFKD 132 >ref|XP_002305873.1| predicted protein [Populus trichocarpa] gi|222848837|gb|EEE86384.1| predicted protein [Populus trichocarpa] Length = 398 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/52 (73%), Positives = 39/52 (75%), Gaps = 3/52 (5%) Frame = +1 Query: 1 QKIRDSNGEFNWKDGENHWENFMKYKEVFGDVELEVKDDSFKG---FDLFGD 147 QKIR S EFNWKDGENHWENF+KYKEVFGDVELEVK G DLF D Sbjct: 81 QKIRISKDEFNWKDGENHWENFLKYKEVFGDVELEVKSKKSSGSGDSDLFKD 132 >emb|CBI33549.3| unnamed protein product [Vitis vinifera] Length = 322 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = +1 Query: 1 QKIRDSNGEFNWKDGENHWENFMKYKEVFGDVELEVKDDSFKGFD 135 QKIR S EFNWKDGENHWENF+KYKEVFGDVELE K+ G D Sbjct: 81 QKIRVSEDEFNWKDGENHWENFLKYKEVFGDVELEAKEKKLGGDD 125