BLASTX nr result
ID: Angelica22_contig00015033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00015033 (592 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36580.1| ARF domain class transcription factor [Malus x do... 67 7e-17 gb|AEX00365.1| IAA26 [Solanum lycopersicum] 64 1e-15 ref|XP_002515959.1| Auxin-responsive protein IAA6, putative [Ric... 63 2e-15 ref|XP_002277798.1| PREDICTED: auxin-responsive protein IAA6-lik... 65 2e-15 emb|CBI20572.3| unnamed protein product [Vitis vinifera] 65 2e-15 >gb|ADL36580.1| ARF domain class transcription factor [Malus x domestica] Length = 325 Score = 67.4 bits (163), Expect(2) = 7e-17 Identities = 36/51 (70%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +1 Query: 1 LFRGLLAAQGEISNS-EKEKMEKTKMIRGLLDGRGDYTLVYEDSEGDRMLV 150 LFRGLLAAQ E N K K E+ K I GLLDG G+YTLVYED+EGDRMLV Sbjct: 238 LFRGLLAAQRESCNGGTKNKQEEEKEITGLLDGSGEYTLVYEDNEGDRMLV 288 Score = 45.1 bits (105), Expect(2) = 7e-17 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +3 Query: 198 LVGDVPWHMFISSAKRLRVLKEISSSYLK 284 LVGDVPWHMF+S+ KRLRVLK S L+ Sbjct: 287 LVGDVPWHMFVSTVKRLRVLKSSELSALR 315 >gb|AEX00365.1| IAA26 [Solanum lycopersicum] Length = 287 Score = 63.5 bits (153), Expect(2) = 1e-15 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 3/53 (5%) Frame = +1 Query: 1 LFRGLLAAQGEIS---NSEKEKMEKTKMIRGLLDGRGDYTLVYEDSEGDRMLV 150 LFRGL+AAQ + S N+EK++ E+ K I GLLDG G+YTLVYED+EGDRMLV Sbjct: 202 LFRGLVAAQNDSSAGGNNEKKEDEE-KAISGLLDGSGEYTLVYEDNEGDRMLV 253 Score = 44.7 bits (104), Expect(2) = 1e-15 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 198 LVGDVPWHMFISSAKRLRVLKEISSSYLKK 287 LVGDVPWHMF+S+ KRLRVLK S L + Sbjct: 252 LVGDVPWHMFVSTVKRLRVLKSSELSTLTR 281 >ref|XP_002515959.1| Auxin-responsive protein IAA6, putative [Ricinus communis] gi|223544864|gb|EEF46379.1| Auxin-responsive protein IAA6, putative [Ricinus communis] Length = 320 Score = 62.8 bits (151), Expect(2) = 2e-15 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +1 Query: 1 LFRGLLAAQGEISNSEKEKMEKTKMIRGLLDGRGDYTLVYEDSEGDRMLV 150 LFRGLLAAQ + S K++ EK I G+LDG G+YTLVYED+EGDRMLV Sbjct: 244 LFRGLLAAQRDSSAGTKQEEEKA--ITGVLDGSGEYTLVYEDNEGDRMLV 291 Score = 45.1 bits (105), Expect(2) = 2e-15 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 198 LVGDVPWHMFISSAKRLRVLKEISSSYLKK 287 LVGDVPWHMF+S+ KRLRVLK S L + Sbjct: 290 LVGDVPWHMFVSTVKRLRVLKSSEVSALSR 319 >ref|XP_002277798.1| PREDICTED: auxin-responsive protein IAA6-like [Vitis vinifera] Length = 345 Score = 65.1 bits (157), Expect(2) = 2e-15 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +1 Query: 1 LFRGLLAAQGEIS--NSEKEKMEKTKMIRGLLDGRGDYTLVYEDSEGDRMLV 150 LFRGLL+AQ E S + KME+ K + GL DG G+YTLVYED+EGDRMLV Sbjct: 248 LFRGLLSAQNESSAGTGNENKMEEAKTMAGLFDGSGEYTLVYEDNEGDRMLV 299 Score = 42.4 bits (98), Expect(2) = 2e-15 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +3 Query: 198 LVGDVPWHMFISSAKRLRVLK 260 LVGDVPWHMF+S+ +RLRVLK Sbjct: 298 LVGDVPWHMFVSTVRRLRVLK 318 >emb|CBI20572.3| unnamed protein product [Vitis vinifera] Length = 205 Score = 65.1 bits (157), Expect(2) = 2e-15 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +1 Query: 1 LFRGLLAAQGEIS--NSEKEKMEKTKMIRGLLDGRGDYTLVYEDSEGDRMLV 150 LFRGLL+AQ E S + KME+ K + GL DG G+YTLVYED+EGDRMLV Sbjct: 108 LFRGLLSAQNESSAGTGNENKMEEAKTMAGLFDGSGEYTLVYEDNEGDRMLV 159 Score = 42.4 bits (98), Expect(2) = 2e-15 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +3 Query: 198 LVGDVPWHMFISSAKRLRVLK 260 LVGDVPWHMF+S+ +RLRVLK Sbjct: 158 LVGDVPWHMFVSTVRRLRVLK 178