BLASTX nr result
ID: Angelica22_contig00014906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00014906 (662 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera] 61 2e-07 >emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera] Length = 1290 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -1 Query: 230 RGLYSLLLMKTYNIELPEAAGRLILGTNKGWLVTLGRDLQIYLLHPLLRLQFALPPMLTF 51 RG YS L K Y I LPE G+ G+ GWLVT+G DL + LL+PL R+Q LP + Sbjct: 983 RGFYSPLSGKVYEIRLPEVVGKWCWGSPYGWLVTIGTDLDMCLLNPLTRVQILLPSLRAC 1042 Query: 50 P 48 P Sbjct: 1043 P 1043