BLASTX nr result
ID: Angelica22_contig00014848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00014848 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29258.3| unnamed protein product [Vitis vinifera] 60 2e-07 emb|CAN72511.1| hypothetical protein VITISV_040731 [Vitis vinifera] 60 2e-07 ref|XP_004152159.1| PREDICTED: ubiquitin thioesterase otubain-li... 58 9e-07 >emb|CBI29258.3| unnamed protein product [Vitis vinifera] Length = 305 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +2 Query: 44 MQNKEELPANATAEAVTSGKASEVDDWEAIKDNDIMQQQSAILAEEAEKIQYVG 205 M+N+E L A+ ++ SEVD WE I+D+DIMQQQSAI AEEAEK+ ++G Sbjct: 1 MENEEGLQADGESDPKAPIPVSEVDAWENIRDDDIMQQQSAIRAEEAEKVPFIG 54 >emb|CAN72511.1| hypothetical protein VITISV_040731 [Vitis vinifera] Length = 66 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +2 Query: 44 MQNKEELPANATAEAVTSGKASEVDDWEAIKDNDIMQQQSAILAEEAEKIQYVG 205 M+N+E L A+ ++ SEVD WE I+D+DIMQQQSAI AEEAEK+ ++G Sbjct: 1 MENEEGLQADGESDPKAPIPVSEVDAWENIRDDDIMQQQSAIRAEEAEKVPFIG 54 >ref|XP_004152159.1| PREDICTED: ubiquitin thioesterase otubain-like [Cucumis sativus] gi|449523221|ref|XP_004168622.1| PREDICTED: ubiquitin thioesterase otubain-like [Cucumis sativus] Length = 302 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = +2 Query: 44 MQNKEELPANATAEAVTSGKASEVDDWEAIKDNDIMQQQSAILAEEAEKIQYVG 205 MQN+E L A+ AE+V S + SE D W + D+DIM Q+SAI +EAEK+ +VG Sbjct: 1 MQNQENLDADGKAESVISIQTSEYDSWGNLGDDDIMLQKSAIFVQEAEKVPFVG 54