BLASTX nr result
ID: Angelica22_contig00014209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00014209 (490 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327754.1| calcium dependent protein kinase 18 [Populus... 59 5e-07 ref|XP_002521658.1| calcium-dependent protein kinase, putative [... 58 7e-07 ref|XP_003519869.1| PREDICTED: calcium-dependent protein kinase ... 55 8e-06 >ref|XP_002327754.1| calcium dependent protein kinase 18 [Populus trichocarpa] gi|222836839|gb|EEE75232.1| calcium dependent protein kinase 18 [Populus trichocarpa] Length = 556 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 PLLVEADIDKDGKISQSEFQRLFRTTSICTRNVNSHATHRESQR 132 PLL EADIDKDGKIS SEF+RL RT S+ +RNV S + HR+S + Sbjct: 512 PLLEEADIDKDGKISLSEFRRLLRTASMSSRNVPSPSGHRKSHK 555 >ref|XP_002521658.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223539049|gb|EEF40645.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 575 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 1 PLLVEADIDKDGKISQSEFQRLFRTTSICTRNVNSHATHRESQR 132 PLL EADIDKDGKIS SEF+RL RT SI +RN S + HR S++ Sbjct: 531 PLLEEADIDKDGKISLSEFRRLLRTASISSRNAPSPSGHRNSRK 574 >ref|XP_003519869.1| PREDICTED: calcium-dependent protein kinase 28-like [Glycine max] Length = 530 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 PLLVEADIDKDGKISQSEFQRLFRTTSICTRNVNSHATHR 120 PLL EADIDKDGKIS EF+RL RT S+ ++NV+S + HR Sbjct: 487 PLLEEADIDKDGKISLPEFRRLLRTASMSSKNVSSPSVHR 526