BLASTX nr result
ID: Angelica22_contig00014115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00014115 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556577.1| PREDICTED: transcription factor bHLH128-like... 61 8e-08 ref|XP_003592849.1| Transcription factor bHLH128 [Medicago trunc... 60 2e-07 ref|XP_004167556.1| PREDICTED: transcription factor bHLH128-like... 58 7e-07 ref|XP_002268535.2| PREDICTED: transcription factor bHLH128 [Vit... 58 7e-07 emb|CBI39159.3| unnamed protein product [Vitis vinifera] 58 7e-07 >ref|XP_003556577.1| PREDICTED: transcription factor bHLH128-like [Glycine max] Length = 286 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 2 VPNMDKQTSYADMLDLAVQHIKGLQTQVQ 88 VPNMDKQTSYADMLDLAVQHIKGLQTQVQ Sbjct: 241 VPNMDKQTSYADMLDLAVQHIKGLQTQVQ 269 >ref|XP_003592849.1| Transcription factor bHLH128 [Medicago truncatula] gi|355481897|gb|AES63100.1| Transcription factor bHLH128 [Medicago truncatula] Length = 343 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 2 VPNMDKQTSYADMLDLAVQHIKGLQTQVQ 88 VPNMDKQTSY+DMLDLAVQHIKGLQTQVQ Sbjct: 298 VPNMDKQTSYSDMLDLAVQHIKGLQTQVQ 326 >ref|XP_004167556.1| PREDICTED: transcription factor bHLH128-like [Cucumis sativus] Length = 356 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 VPNMDKQTSYADMLDLAVQHIKGLQTQVQL 91 VPNMDKQTSY+DMLDLAVQHIKGLQ Q+Q+ Sbjct: 325 VPNMDKQTSYSDMLDLAVQHIKGLQNQIQV 354 >ref|XP_002268535.2| PREDICTED: transcription factor bHLH128 [Vitis vinifera] Length = 357 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VPNMDKQTSYADMLDLAVQHIKGLQTQVQ 88 VPNMDKQTSYADMLDLAVQHIKGLQ +VQ Sbjct: 312 VPNMDKQTSYADMLDLAVQHIKGLQNEVQ 340 >emb|CBI39159.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VPNMDKQTSYADMLDLAVQHIKGLQTQVQ 88 VPNMDKQTSYADMLDLAVQHIKGLQ +VQ Sbjct: 365 VPNMDKQTSYADMLDLAVQHIKGLQNEVQ 393