BLASTX nr result
ID: Angelica22_contig00013762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00013762 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306839.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_002532369.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 ref|XP_003541347.1| PREDICTED: autophagy-related protein 9-like ... 69 3e-10 ref|XP_003536935.1| PREDICTED: autophagy-related protein 9-like ... 69 3e-10 ref|NP_850164.1| protein autophagy 9 [Arabidopsis thaliana] gi|1... 69 4e-10 >ref|XP_002306839.1| predicted protein [Populus trichocarpa] gi|222856288|gb|EEE93835.1| predicted protein [Populus trichocarpa] Length = 876 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = +3 Query: 81 YTGMMLLEEMASIFLTRYLLIFIVPERVDEILQFIDNFTVDV 206 YTGMMLLEEMASIFLT +LL+F+VP+RVD+ILQFI +FTVDV Sbjct: 503 YTGMMLLEEMASIFLTPFLLLFVVPKRVDDILQFIADFTVDV 544 >ref|XP_002532369.1| conserved hypothetical protein [Ricinus communis] gi|223527925|gb|EEF30012.1| conserved hypothetical protein [Ricinus communis] Length = 864 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = +3 Query: 81 YTGMMLLEEMASIFLTRYLLIFIVPERVDEILQFIDNFTVDV 206 YTGMMLLEEMASIFLT +LL+FIVP+RVD+ILQFI +FT+DV Sbjct: 503 YTGMMLLEEMASIFLTPFLLLFIVPKRVDDILQFIADFTMDV 544 >ref|XP_003541347.1| PREDICTED: autophagy-related protein 9-like [Glycine max] Length = 868 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +3 Query: 81 YTGMMLLEEMASIFLTRYLLIFIVPERVDEILQFIDNFTVDV 206 Y+GMMLLEEMASIFLT YLL+ +VP+RVD+ILQFI +FTVDV Sbjct: 503 YSGMMLLEEMASIFLTPYLLLLVVPKRVDDILQFIADFTVDV 544 >ref|XP_003536935.1| PREDICTED: autophagy-related protein 9-like [Glycine max] Length = 863 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +3 Query: 81 YTGMMLLEEMASIFLTRYLLIFIVPERVDEILQFIDNFTVDV 206 Y+GMMLLEEMASIFLT YLL+ +VP+RVD+ILQFI +FTVDV Sbjct: 503 YSGMMLLEEMASIFLTPYLLLLVVPKRVDDILQFIADFTVDV 544 >ref|NP_850164.1| protein autophagy 9 [Arabidopsis thaliana] gi|19715618|gb|AAL91630.1| At2g31260/F16D14.10 [Arabidopsis thaliana] gi|19912149|dbj|BAB88386.1| autophagy 9 [Arabidopsis thaliana] gi|20466356|gb|AAM20495.1| unknown protein [Arabidopsis thaliana] gi|23198070|gb|AAN15562.1| unknown protein [Arabidopsis thaliana] gi|23463043|gb|AAN33191.1| At2g31260/F16D14.10 [Arabidopsis thaliana] gi|330253421|gb|AEC08515.1| protein autophagy 9 [Arabidopsis thaliana] Length = 866 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = +3 Query: 81 YTGMMLLEEMASIFLTRYLLIFIVPERVDEILQFIDNFTVDV 206 YTGMMLLEE+ASIF+T +LL+F+VP+RVD+ILQFI +FTVD+ Sbjct: 505 YTGMMLLEEIASIFITPFLLMFVVPKRVDDILQFIKDFTVDI 546