BLASTX nr result
ID: Angelica22_contig00013734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00013734 (822 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arab... 83 8e-14 ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] ... 80 4e-13 ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|... 80 4e-13 ref|XP_002521418.1| nucleic acid binding protein, putative [Rici... 79 2e-12 ref|XP_003608189.1| hypothetical protein MTR_4g090520 [Medicago ... 78 3e-12 >ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] gi|297315712|gb|EFH46135.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] Length = 131 Score = 82.8 bits (203), Expect = 8e-14 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = +2 Query: 404 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRSXXXXXXXXXXXXCSMDCKKKCTASC 574 VVRP VTC+ KGPCYGKKLRCP+KCF S+SRS C+MDCKKKC A C Sbjct: 75 VVRPTVTCREKGPCYGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMDCKKKCIAYC 131 >ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] gi|332659082|gb|AEE84482.1| glycine-rich protein [Arabidopsis thaliana] Length = 98 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/57 (63%), Positives = 39/57 (68%) Frame = +2 Query: 404 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRSXXXXXXXXXXXXCSMDCKKKCTASC 574 VVRP VTCK KGPC GKKLRCP+KCF S+SRS C+MDCKKKC A C Sbjct: 42 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMDCKKKCIAYC 98 >ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|13507541|gb|AAK28633.1|AF360336_1 unknown protein [Arabidopsis thaliana] gi|4455270|emb|CAB36806.1| putative protein [Arabidopsis thaliana] gi|7268959|emb|CAB81269.1| putative protein [Arabidopsis thaliana] gi|15293275|gb|AAK93748.1| unknown protein [Arabidopsis thaliana] gi|16648720|gb|AAL25552.1| AT4g21620/F17L22_80 [Arabidopsis thaliana] gi|21553868|gb|AAM62961.1| unknown [Arabidopsis thaliana] gi|110742179|dbj|BAE99017.1| hypothetical protein [Arabidopsis thaliana] gi|332659081|gb|AEE84481.1| glycine-rich protein [Arabidopsis thaliana] Length = 131 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/57 (63%), Positives = 39/57 (68%) Frame = +2 Query: 404 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRSXXXXXXXXXXXXCSMDCKKKCTASC 574 VVRP VTCK KGPC GKKLRCP+KCF S+SRS C+MDCKKKC A C Sbjct: 75 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMDCKKKCIAYC 131 >ref|XP_002521418.1| nucleic acid binding protein, putative [Ricinus communis] gi|223539317|gb|EEF40908.1| nucleic acid binding protein, putative [Ricinus communis] Length = 147 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = +2 Query: 404 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRSXXXXXXXXXXXXCSMDCKKKCTASC 574 ++RP V CK KGPCY KKL CP+KCFTS+SRS C+MDCKKKC A C Sbjct: 91 IIRPTVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTMDCKKKCIAYC 147 >ref|XP_003608189.1| hypothetical protein MTR_4g090520 [Medicago truncatula] gi|355509244|gb|AES90386.1| hypothetical protein MTR_4g090520 [Medicago truncatula] Length = 138 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +2 Query: 404 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRSXXXXXXXXXXXXCSMDCKKKCTASC 574 V+RP V CK +GPCY KK+ CP++CFTS+SRS C++DCKKKCTASC Sbjct: 82 VIRPTVVCKDRGPCYQKKVTCPARCFTSFSRSGKGYGGGGGGGGCTIDCKKKCTASC 138