BLASTX nr result
ID: Angelica22_contig00013685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00013685 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534381.1| PREDICTED: protein transport protein SEC31-l... 50 2e-06 ref|XP_003534382.1| PREDICTED: protein transport protein SEC31-l... 50 2e-06 ref|XP_002527953.1| nucleotide binding protein, putative [Ricinu... 50 3e-06 ref|XP_004163925.1| PREDICTED: protein transport protein Sec31A-... 55 6e-06 ref|XP_004149729.1| PREDICTED: protein transport protein Sec31A-... 55 6e-06 >ref|XP_003534381.1| PREDICTED: protein transport protein SEC31-like isoform 1 [Glycine max] Length = 1118 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 144 EDDKETWGFLNVIFEDDGIART*LLTHLGW 55 E+++ETWGFL V+FEDDG ART LL+HLG+ Sbjct: 437 EEERETWGFLKVMFEDDGTARTKLLSHLGF 466 Score = 26.2 bits (56), Expect(2) = 2e-06 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -1 Query: 59 VGFSLPTEAKGVMQDSLSQ 3 +GF++P+EAK + D LSQ Sbjct: 464 LGFNVPSEAKDTVNDDLSQ 482 >ref|XP_003534382.1| PREDICTED: protein transport protein SEC31-like isoform 2 [Glycine max] Length = 1106 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 144 EDDKETWGFLNVIFEDDGIART*LLTHLGW 55 E+++ETWGFL V+FEDDG ART LL+HLG+ Sbjct: 425 EEERETWGFLKVMFEDDGTARTKLLSHLGF 454 Score = 26.2 bits (56), Expect(2) = 2e-06 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -1 Query: 59 VGFSLPTEAKGVMQDSLSQ 3 +GF++P+EAK + D LSQ Sbjct: 452 LGFNVPSEAKDTVNDDLSQ 470 >ref|XP_002527953.1| nucleotide binding protein, putative [Ricinus communis] gi|223532657|gb|EEF34442.1| nucleotide binding protein, putative [Ricinus communis] Length = 1055 Score = 50.4 bits (119), Expect(2) = 3e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 144 EDDKETWGFLNVIFEDDGIART*LLTHLGW 55 EDD+ETWGFL V+FE+DG ART +L+HLG+ Sbjct: 334 EDDRETWGFLMVMFEEDGTARTKMLSHLGF 363 Score = 25.4 bits (54), Expect(2) = 3e-06 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 59 VGFSLPTEAKGVMQDSLSQ 3 +GFS+P E K +QD +S+ Sbjct: 361 LGFSVPVEEKDALQDDISE 379 >ref|XP_004163925.1| PREDICTED: protein transport protein Sec31A-like, partial [Cucumis sativus] Length = 947 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 147 LEDDKETWGFLNVIFEDDGIART*LLTHLGW 55 LEDD+ETWGFL V+FEDDG ART LL+HLG+ Sbjct: 271 LEDDRETWGFLKVMFEDDGTARTKLLSHLGF 301 >ref|XP_004149729.1| PREDICTED: protein transport protein Sec31A-like [Cucumis sativus] Length = 1112 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 147 LEDDKETWGFLNVIFEDDGIART*LLTHLGW 55 LEDD+ETWGFL V+FEDDG ART LL+HLG+ Sbjct: 436 LEDDRETWGFLKVMFEDDGTARTKLLSHLGF 466