BLASTX nr result
ID: Angelica22_contig00013188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00013188 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 ... 90 2e-16 emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] 90 2e-16 ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated rec... 86 3e-15 ref|XP_002311408.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus... 82 3e-14 >ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera] gi|297738231|emb|CBI27432.3| unnamed protein product [Vitis vinifera] Length = 625 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -3 Query: 410 EKWEATQRAEATRCRANEFSSSERYSDLTDDSSVLVQAMELSGPR 276 EKWEATQRAEATRC+ANEFSSSERYSDLTDDSS+LVQAMELSGPR Sbjct: 581 EKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR 625 >emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] Length = 609 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -3 Query: 410 EKWEATQRAEATRCRANEFSSSERYSDLTDDSSVLVQAMELSGPR 276 EKWEATQRAEATRC+ANEFSSSERYSDLTDDSS+LVQAMELSGPR Sbjct: 565 EKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR 609 >ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi|223546140|gb|EEF47642.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] Length = 576 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 410 EKWEATQRAEATRCRANEFSSSERYSDLTDDSSVLVQAMELSGPR 276 EKWEA+QRAEATR RANEFSSSERYSDLTDDSS+LVQAMELSGPR Sbjct: 532 EKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR 576 >ref|XP_002311408.1| predicted protein [Populus trichocarpa] gi|222851228|gb|EEE88775.1| predicted protein [Populus trichocarpa] Length = 622 Score = 84.0 bits (206), Expect = 1e-14 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 410 EKWEATQRAEATRCRANEFSSSERYSDLTDDSSVLVQAMELSGPR 276 EKWEA+QRAE TR RANEFSSSERYSDLTDDSS+LVQAMELSGPR Sbjct: 578 EKWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR 622 >gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa] Length = 622 Score = 82.4 bits (202), Expect = 3e-14 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 410 EKWEATQRAEATRCRANEFSSSERYSDLTDDSSVLVQAMELSGPR 276 EKWEA+QRAE +R RANEFSSSERYSDLTDDSS+LVQAMELSGPR Sbjct: 578 EKWEASQRAEESRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR 622