BLASTX nr result
ID: Angelica22_contig00012074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00012074 (890 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW47276.1| ribosomal protein S4 [Platanus occidentalis] 121 2e-25 gb|AAW47270.1| ribosomal protein S4 [Calycanthus floridus] 121 2e-25 gb|AAW47278.1| ribosomal protein S4 [Lonicera sp. Bergthorsson 0... 119 7e-25 ref|YP_004237282.1| ribosomal protein S4 (mitochondrion) [Ricinu... 119 9e-25 ref|XP_002535173.1| Mitochondrial ribosomal protein S4, putative... 119 9e-25 >gb|AAW47276.1| ribosomal protein S4 [Platanus occidentalis] Length = 320 Score = 121 bits (303), Expect = 2e-25 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = -1 Query: 461 SVEKIIGKFRDHPVRM*RRTKTEWFRLLKTKRGCRLLLKDRFLQQLRSSMQEEDLERTKK 282 SVEKIIGKF DHPVRM RRTKTEWFRLLKTKRGCRLLLK RFLQQLRSSMQEEDLERTKK Sbjct: 158 SVEKIIGKFLDHPVRMWRRTKTEWFRLLKTKRGCRLLLKSRFLQQLRSSMQEEDLERTKK 217 Query: 281 FGSK 270 FGS+ Sbjct: 218 FGSE 221 >gb|AAW47270.1| ribosomal protein S4 [Calycanthus floridus] Length = 319 Score = 121 bits (303), Expect = 2e-25 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = -1 Query: 461 SVEKIIGKFRDHPVRM*RRTKTEWFRLLKTKRGCRLLLKDRFLQQLRSSMQEEDLERTKK 282 SVEKIIGKF DHPVRM RRTKTEWFRLLKTKRGCRLLLK RFLQQLRSSMQEEDLERTKK Sbjct: 158 SVEKIIGKFLDHPVRMWRRTKTEWFRLLKTKRGCRLLLKSRFLQQLRSSMQEEDLERTKK 217 Query: 281 FGSK 270 FGS+ Sbjct: 218 FGSE 221 >gb|AAW47278.1| ribosomal protein S4 [Lonicera sp. Bergthorsson 0301] Length = 318 Score = 119 bits (299), Expect = 7e-25 Identities = 59/64 (92%), Positives = 61/64 (95%) Frame = -1 Query: 461 SVEKIIGKFRDHPVRM*RRTKTEWFRLLKTKRGCRLLLKDRFLQQLRSSMQEEDLERTKK 282 SVEKIIGKF DHPVRM RRTKTEWFRLLKTKRGCRLLLK RFL+QLRSSMQEEDLERTKK Sbjct: 156 SVEKIIGKFLDHPVRMWRRTKTEWFRLLKTKRGCRLLLKSRFLKQLRSSMQEEDLERTKK 215 Query: 281 FGSK 270 FGS+ Sbjct: 216 FGSE 219 >ref|YP_004237282.1| ribosomal protein S4 (mitochondrion) [Ricinus communis] gi|322394289|gb|ADW96046.1| ribosomal protein S4 (mitochondrion) [Ricinus communis] Length = 352 Score = 119 bits (298), Expect = 9e-25 Identities = 59/64 (92%), Positives = 60/64 (93%) Frame = -1 Query: 461 SVEKIIGKFRDHPVRM*RRTKTEWFRLLKTKRGCRLLLKDRFLQQLRSSMQEEDLERTKK 282 SVEKIIGKF DHPVRM RRTKTEWF LLKTKRGCRLLLK RFLQQLRSSMQEEDLERTKK Sbjct: 165 SVEKIIGKFLDHPVRMWRRTKTEWFHLLKTKRGCRLLLKSRFLQQLRSSMQEEDLERTKK 224 Query: 281 FGSK 270 FGS+ Sbjct: 225 FGSE 228 >ref|XP_002535173.1| Mitochondrial ribosomal protein S4, putative [Ricinus communis] gi|223523829|gb|EEF27209.1| Mitochondrial ribosomal protein S4, putative [Ricinus communis] Length = 276 Score = 119 bits (298), Expect = 9e-25 Identities = 59/64 (92%), Positives = 60/64 (93%) Frame = -1 Query: 461 SVEKIIGKFRDHPVRM*RRTKTEWFRLLKTKRGCRLLLKDRFLQQLRSSMQEEDLERTKK 282 SVEKIIGKF DHPVRM RRTKTEWF LLKTKRGCRLLLK RFLQQLRSSMQEEDLERTKK Sbjct: 89 SVEKIIGKFLDHPVRMWRRTKTEWFHLLKTKRGCRLLLKSRFLQQLRSSMQEEDLERTKK 148 Query: 281 FGSK 270 FGS+ Sbjct: 149 FGSE 152