BLASTX nr result
ID: Angelica22_contig00011921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00011921 (784 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313779.1| predicted protein [Populus trichocarpa] gi|2... 67 3e-09 ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago ... 67 6e-09 ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245... 64 3e-08 ref|NP_001236665.1| uncharacterized protein LOC100500603 precurs... 63 6e-08 emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] 62 1e-07 >ref|XP_002313779.1| predicted protein [Populus trichocarpa] gi|222850187|gb|EEE87734.1| predicted protein [Populus trichocarpa] Length = 94 Score = 67.4 bits (163), Expect = 3e-09 Identities = 38/69 (55%), Positives = 44/69 (63%), Gaps = 5/69 (7%) Frame = +1 Query: 217 GRQLRSVNL---EKEAMASTYK--GHHQLHQGEETKIIHGRLLRVNTKDYGNYDPAPTFV 381 GR+ +SVN E E A+TY+ H E T I H RLL+ NTKDYGNY PAP V Sbjct: 27 GRRSKSVNKLAEEVEVSAATYEEISSKPSHNNEATTI-HERLLKANTKDYGNYKPAPALV 85 Query: 382 KPPFKLIPN 408 +PPFKLIPN Sbjct: 86 RPPFKLIPN 94 >ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|355521771|gb|AET02225.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|388492214|gb|AFK34173.1| unknown [Medicago truncatula] Length = 91 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 298 EETKIIHGRLLRVNTKDYGNYDPAPTFVKPPFKLIPN 408 EE + IH RLLR NTKDYG YDP+PTF KPPFKLIPN Sbjct: 55 EEVRSIHERLLRANTKDYGRYDPSPTFSKPPFKLIPN 91 >ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245294 [Vitis vinifera] gi|297744426|emb|CBI37688.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +1 Query: 289 HQGEETKIIHGRLLRVNTKDYGNYDPAPTFVKPPFKLIPN 408 HQ + IH RLLR NT+DYGNYDPAP KPPFKLIPN Sbjct: 56 HQYRRAEAIHERLLRANTRDYGNYDPAPALGKPPFKLIPN 95 >ref|NP_001236665.1| uncharacterized protein LOC100500603 precursor [Glycine max] gi|255630736|gb|ACU15729.1| unknown [Glycine max] Length = 93 Score = 63.2 bits (152), Expect = 6e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 298 EETKIIHGRLLRVNTKDYGNYDPAPTFVKPPFKLIPN 408 EE + IH RLLR NTKDYG YDP+P+ KPPFKLIPN Sbjct: 57 EEVRTIHERLLRANTKDYGRYDPSPSLSKPPFKLIPN 93 >emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] Length = 249 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +1 Query: 289 HQGEETKIIHGRLLRVNTKDYGNYDPAPTFVKPPFKLIPN 408 H + IH RLLR NT+DYGNYDPAP KPPFKLIPN Sbjct: 210 HHYRRAEAIHERLLRANTRDYGNYDPAPALGKPPFKLIPN 249