BLASTX nr result
ID: Angelica22_contig00010618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00010618 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea] 63 2e-08 ref|XP_004144852.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sa... 63 2e-08 gb|AAB18228.1| MipE [Mesembryanthemum crystallinum] 63 2e-08 gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta v... 63 2e-08 gb|AAA68701.1| similar to mipB gene product in Mesembryanthemum ... 63 2e-08 >gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea] Length = 278 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 426 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 334 VGALAAAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 248 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 278 >ref|XP_004144852.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus] gi|449530586|ref|XP_004172275.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus] Length = 280 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 426 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 334 VGALAAAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 250 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 280 >gb|AAB18228.1| MipE [Mesembryanthemum crystallinum] Length = 284 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 426 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 334 VGALAAAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 254 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 284 >gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta vulgaris] Length = 281 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 426 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 334 VGALAAAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 251 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 281 >gb|AAA68701.1| similar to mipB gene product in Mesembryanthemum crystallinum, encoded by Genbank Accession Number L36097; MIP homolog; Method: conceptual translation supplied by author, partial [Mesembryanthemum crystallinum] Length = 252 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 426 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 334 VGALAAAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 222 VGALAAAAYHQYILRAAAIKALGSFRSNPTN 252