BLASTX nr result
ID: Angelica22_contig00010349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00010349 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512773.1| dead box ATP-dependent RNA helicase, putativ... 55 5e-06 >ref|XP_002512773.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223547784|gb|EEF49276.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Length = 540 Score = 55.5 bits (132), Expect = 5e-06 Identities = 33/78 (42%), Positives = 38/78 (48%), Gaps = 3/78 (3%) Frame = +3 Query: 90 MNPYDSRFADPSSYRQRRSDLIXXXXXXXXXXXXXXXXDFSRRGPPPYGMQHPVMGTGSG 269 MNPYD R++DP SYR RRSDL S P PYG P+ +G Sbjct: 1 MNPYDHRYSDPDSYRHRRSDLTGASPPAGPPPMLGRSYGRSGHPPVPYGGPPPL--NFAG 58 Query: 270 REGG---FHGYPPFQPSV 314 R GG GYPPF+P V Sbjct: 59 RGGGPAPVGGYPPFEPPV 76