BLASTX nr result
ID: Angelica22_contig00010348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00010348 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB88264.1| callose synthase catalytic subunit-like protein ... 94 1e-27 ref|XP_002304888.1| predicted protein [Populus trichocarpa] gi|2... 94 1e-27 ref|NP_196804.6| callose synthase [Arabidopsis thaliana] gi|3575... 94 1e-27 gb|ADM72799.1| callose synthase 3 [Arabidopsis thaliana] 94 1e-27 ref|NP_001154712.2| callose synthase [Arabidopsis thaliana] gi|3... 94 1e-27 >emb|CAB88264.1| callose synthase catalytic subunit-like protein [Arabidopsis thaliana] Length = 1963 Score = 93.6 bits (231), Expect(2) = 1e-27 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 432 GSVRTLARGYEIVMGLFLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 295 GSVRTLARGYEIVMGL LFTPVAFLAWFPFVSEFQTRMLFNQAFSR Sbjct: 1897 GSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 1942 Score = 54.7 bits (130), Expect(2) = 1e-27 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 230 NQAFSRGLQISRILGGHRKDRAARNKE 150 NQAFSRGLQISRILGGHRKDR++RNKE Sbjct: 1937 NQAFSRGLQISRILGGHRKDRSSRNKE 1963 >ref|XP_002304888.1| predicted protein [Populus trichocarpa] gi|222842320|gb|EEE79867.1| predicted protein [Populus trichocarpa] Length = 1961 Score = 93.6 bits (231), Expect(2) = 1e-27 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 432 GSVRTLARGYEIVMGLFLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 295 GSVRTLARGYEIVMGL LFTPVAFLAWFPFVSEFQTRMLFNQAFSR Sbjct: 1895 GSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 1940 Score = 54.7 bits (130), Expect(2) = 1e-27 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 230 NQAFSRGLQISRILGGHRKDRAARNKE 150 NQAFSRGLQISRILGGHRKDR++RNKE Sbjct: 1935 NQAFSRGLQISRILGGHRKDRSSRNKE 1961 >ref|NP_196804.6| callose synthase [Arabidopsis thaliana] gi|357529555|sp|Q9LXT9.3|CALS3_ARATH RecName: Full=Callose synthase 3; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 12 gi|332004456|gb|AED91839.1| callose synthase [Arabidopsis thaliana] Length = 1955 Score = 93.6 bits (231), Expect(2) = 1e-27 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 432 GSVRTLARGYEIVMGLFLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 295 GSVRTLARGYEIVMGL LFTPVAFLAWFPFVSEFQTRMLFNQAFSR Sbjct: 1889 GSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 1934 Score = 54.7 bits (130), Expect(2) = 1e-27 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 230 NQAFSRGLQISRILGGHRKDRAARNKE 150 NQAFSRGLQISRILGGHRKDR++RNKE Sbjct: 1929 NQAFSRGLQISRILGGHRKDRSSRNKE 1955 >gb|ADM72799.1| callose synthase 3 [Arabidopsis thaliana] Length = 1947 Score = 93.6 bits (231), Expect(2) = 1e-27 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 432 GSVRTLARGYEIVMGLFLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 295 GSVRTLARGYEIVMGL LFTPVAFLAWFPFVSEFQTRMLFNQAFSR Sbjct: 1881 GSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 1926 Score = 54.7 bits (130), Expect(2) = 1e-27 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 230 NQAFSRGLQISRILGGHRKDRAARNKE 150 NQAFSRGLQISRILGGHRKDR++RNKE Sbjct: 1921 NQAFSRGLQISRILGGHRKDRSSRNKE 1947 >ref|NP_001154712.2| callose synthase [Arabidopsis thaliana] gi|332004457|gb|AED91840.1| callose synthase [Arabidopsis thaliana] Length = 1914 Score = 93.6 bits (231), Expect(2) = 1e-27 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 432 GSVRTLARGYEIVMGLFLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 295 GSVRTLARGYEIVMGL LFTPVAFLAWFPFVSEFQTRMLFNQAFSR Sbjct: 1848 GSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSR 1893 Score = 54.7 bits (130), Expect(2) = 1e-27 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 230 NQAFSRGLQISRILGGHRKDRAARNKE 150 NQAFSRGLQISRILGGHRKDR++RNKE Sbjct: 1888 NQAFSRGLQISRILGGHRKDRSSRNKE 1914