BLASTX nr result
ID: Angelica22_contig00010305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00010305 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|3... 62 5e-08 ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|2... 62 5e-08 emb|CAA06819.1| cysteine synthase, O-acetyl-L-serine (thiol)-lya... 61 1e-07 gb|AFK39569.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_002517133.1| cysteine synthase, putative [Ricinus communi... 59 3e-07 >ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|355512059|gb|AES93682.1| Cysteine synthase [Medicago truncatula] Length = 284 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 387 VIFPSFGERYLSSVLFESVRREAETMTFEP 298 V+FPSFGERYLSSVLFESVRREAETMTFEP Sbjct: 255 VVFPSFGERYLSSVLFESVRREAETMTFEP 284 >ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|217074042|gb|ACJ85381.1| unknown [Medicago truncatula] gi|355512058|gb|AES93681.1| Cysteine synthase [Medicago truncatula] Length = 325 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 387 VIFPSFGERYLSSVLFESVRREAETMTFEP 298 V+FPSFGERYLSSVLFESVRREAETMTFEP Sbjct: 296 VVFPSFGERYLSSVLFESVRREAETMTFEP 325 >emb|CAA06819.1| cysteine synthase, O-acetyl-L-serine (thiol)-lyase [Cicer arietinum] Length = 266 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 387 VIFPSFGERYLSSVLFESVRREAETMTFEP 298 V+FPSFGERYLSSVLFESVRR+AETMTFEP Sbjct: 237 VVFPSFGERYLSSVLFESVRRQAETMTFEP 266 >gb|AFK39569.1| unknown [Medicago truncatula] Length = 325 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 387 VIFPSFGERYLSSVLFESVRREAETMTFEP 298 V+FPS GERYLSSVLFESVRREAETMTFEP Sbjct: 296 VVFPSLGERYLSSVLFESVRREAETMTFEP 325 >ref|XP_002517133.1| cysteine synthase, putative [Ricinus communis] gi|223543768|gb|EEF45296.1| cysteine synthase, putative [Ricinus communis] Length = 325 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 387 VIFPSFGERYLSSVLFESVRREAETMTFEP 298 V+FPSFGERYLSSVLFESVRREAE+MT+EP Sbjct: 296 VVFPSFGERYLSSVLFESVRREAESMTYEP 325