BLASTX nr result
ID: Angelica22_contig00009907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00009907 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33744.1| hypothetical protein [Cucumis melo subsp. melo] 55 6e-06 >gb|ADN33744.1| hypothetical protein [Cucumis melo subsp. melo] Length = 498 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 246 KWNQEKLLDEMRREKSLLDQANFNFEIKKKEFVRFLAE 133 KW +EK+L++MRRE++LLD NFE KK EFV+FLAE Sbjct: 354 KWKKEKMLEDMRRERALLDSLKLNFEKKKAEFVQFLAE 391