BLASTX nr result
ID: Angelica22_contig00009834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00009834 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37109.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002279070.1| PREDICTED: probable inorganic phosphate tran... 62 5e-08 emb|CAN65533.1| hypothetical protein VITISV_038520 [Vitis vinifera] 62 6e-08 gb|AFY06658.1| phosphate transporter [Citrus trifoliata] 60 2e-07 ref|NP_181428.1| inorganic phosphate transporter 1-4 [Arabidopsi... 59 4e-07 >emb|CBI37109.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -2 Query: 290 ALLVIGFINLAGTLCTFLVPESKGKSLEEISGENEDTKANANASTCET 147 ALLV+G INL G + TF+VPESKGKSLEE+SGE ED ANAS T Sbjct: 299 ALLVLGGINLLGFIFTFMVPESKGKSLEEMSGETEDNNEQANASVPST 346 >ref|XP_002279070.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Vitis vinifera] Length = 525 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 290 ALLVIGFINLAGTLCTFLVPESKGKSLEEISGENEDTKANANAS 159 ALLV+G INL G + TF+VPESKGKSLEE+SGE ED ANAS Sbjct: 481 ALLVLGGINLLGFIFTFMVPESKGKSLEEMSGETEDNNEQANAS 524 >emb|CAN65533.1| hypothetical protein VITISV_038520 [Vitis vinifera] Length = 512 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 290 ALLVIGFINLAGTLCTFLVPESKGKSLEEISGENEDTKANANAS 159 ALLV+G INL G + TF+VPESKGKSLEE+SGE ED ANAS Sbjct: 468 ALLVLGGINLLGFIFTFMVPESKGKSLEEMSGEXEDNNEQANAS 511 >gb|AFY06658.1| phosphate transporter [Citrus trifoliata] Length = 540 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 290 ALLVIGFINLAGTLCTFLVPESKGKSLEEISGENEDTKA 174 +L+V+GF+NL G L TFLVPESKGKSLEE+SGEN+D A Sbjct: 485 SLIVLGFVNLLGLLFTFLVPESKGKSLEEMSGENQDEGA 523 >ref|NP_181428.1| inorganic phosphate transporter 1-4 [Arabidopsis thaliana] gi|75307847|sp|Q96303.1|PHT14_ARATH RecName: Full=Inorganic phosphate transporter 1-4; Short=AtPht1;4; AltName: Full=H(+)/Pi cotransporter gi|1502430|gb|AAB17266.1| phosphate transporter [Arabidopsis thaliana] gi|2564661|gb|AAB88291.1| phosphate transporter [Arabidopsis thaliana] gi|3869206|dbj|BAA34398.1| Phosphate Transporter 4 [Arabidopsis thaliana] gi|3928081|gb|AAC79607.1| phosphate transporter (AtPT2) [Arabidopsis thaliana] gi|330254521|gb|AEC09615.1| inorganic phosphate transporter 1-4 [Arabidopsis thaliana] Length = 534 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 290 ALLVIGFINLAGTLCTFLVPESKGKSLEEISGENEDTKANANAS 159 +L+V+G +N G L TFLVPESKGKSLEE+SGENED + + N S Sbjct: 485 SLIVLGVVNFLGILFTFLVPESKGKSLEEMSGENEDNENSNNDS 528