BLASTX nr result
ID: Angelica22_contig00009266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00009266 (999 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO42812.1| At1g18890 [Arabidopsis thaliana] 61 1e-12 ref|NP_564066.2| calcium-dependent protein kinase 1 [Arabidopsis... 61 1e-12 dbj|BAA04829.1| calcium-dependent protein kinase [Arabidopsis th... 61 3e-12 ref|XP_002509886.1| calcium-dependent protein kinase, putative [... 55 1e-09 ref|XP_002888057.1| predicted protein [Arabidopsis lyrata subsp.... 50 3e-09 >gb|AAO42812.1| At1g18890 [Arabidopsis thaliana] Length = 545 Score = 60.8 bits (146), Expect(2) = 1e-12 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +1 Query: 706 GDKFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 825 GDKF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 218 GDKFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 258 Score = 38.9 bits (89), Expect(2) = 1e-12 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +3 Query: 801 GVILYILLCGVPPFWA 848 GVI+YILLCGVPPFWA Sbjct: 250 GVIIYILLCGVPPFWA 265 >ref|NP_564066.2| calcium-dependent protein kinase 1 [Arabidopsis thaliana] gi|75336122|sp|Q9M9V8.1|CDPKA_ARATH RecName: Full=Calcium-dependent protein kinase 10; AltName: Full=Calcium-dependent protein kinase isoform CDPK1; Short=AtCDPK1 gi|6730697|gb|AAF27092.1|AC011809_1 calcium-dependent protein kinase 1 [Arabidopsis thaliana] gi|110743414|dbj|BAE99593.1| calcium-dependent protein kinase [Arabidopsis thaliana] gi|332191656|gb|AEE29777.1| calcium-dependent protein kinase 1 [Arabidopsis thaliana] Length = 545 Score = 60.8 bits (146), Expect(2) = 1e-12 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +1 Query: 706 GDKFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 825 GDKF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 218 GDKFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 258 Score = 38.9 bits (89), Expect(2) = 1e-12 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +3 Query: 801 GVILYILLCGVPPFWA 848 GVI+YILLCGVPPFWA Sbjct: 250 GVIIYILLCGVPPFWA 265 >dbj|BAA04829.1| calcium-dependent protein kinase [Arabidopsis thaliana] Length = 493 Score = 60.8 bits (146), Expect(2) = 3e-12 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +1 Query: 706 GDKFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 825 GDKF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 166 GDKFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 206 Score = 37.4 bits (85), Expect(2) = 3e-12 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 801 GVILYILLCGVPPFWA 848 GVI+YILLCG PPFWA Sbjct: 198 GVIIYILLCGAPPFWA 213 >ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223549785|gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 528 Score = 55.5 bits (132), Expect(2) = 1e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 706 GDKFSEIVGSPYYIAAEVLKRNYGPEIDIWSA 801 GD F ++VGS YY+A EVL+RNYGP IDIWSA Sbjct: 232 GDTFKDLVGSAYYVAPEVLRRNYGPAIDIWSA 263 Score = 34.3 bits (77), Expect(2) = 1e-09 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 801 GVILYILLCGVPPFW 845 GVILYILL GVPPFW Sbjct: 264 GVILYILLSGVPPFW 278 >ref|XP_002888057.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297333898|gb|EFH64316.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 553 Score = 50.1 bits (118), Expect(2) = 3e-09 Identities = 25/41 (60%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +1 Query: 706 GDKFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 825 G + +IVGS YY+A EVLKRNYG IDIWSA V +I C Sbjct: 254 GRVYEDIVGSAYYVAPEVLKRNYGKAIDIWSAGVILYILLC 294 Score = 38.1 bits (87), Expect(2) = 3e-09 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +3 Query: 801 GVILYILLCGVPPFWA 848 GVILYILLCG PPFWA Sbjct: 286 GVILYILLCGTPPFWA 301