BLASTX nr result
ID: Angelica22_contig00009197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00009197 (791 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arab... 62 1e-07 ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] ... 60 5e-07 ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|... 60 5e-07 ref|XP_002521418.1| nucleic acid binding protein, putative [Rici... 59 1e-06 >ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] gi|297315712|gb|EFH46135.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] Length = 131 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -1 Query: 416 VIRPVVTCKIKGPCYGKKLRCPAKCFTSWSXXXXXXXXXXXXXGCSMD 273 V+RP VTC+ KGPCYGKKLRCPAKCF S+S GC+MD Sbjct: 75 VVRPTVTCREKGPCYGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMD 122 >ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] gi|332659082|gb|AEE84482.1| glycine-rich protein [Arabidopsis thaliana] Length = 98 Score = 60.1 bits (144), Expect = 5e-07 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -1 Query: 416 VIRPVVTCKIKGPCYGKKLRCPAKCFTSWSXXXXXXXXXXXXXGCSMD 273 V+RP VTCK KGPC GKKLRCPAKCF S+S GC+MD Sbjct: 42 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMD 89 >ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|13507541|gb|AAK28633.1|AF360336_1 unknown protein [Arabidopsis thaliana] gi|4455270|emb|CAB36806.1| putative protein [Arabidopsis thaliana] gi|7268959|emb|CAB81269.1| putative protein [Arabidopsis thaliana] gi|15293275|gb|AAK93748.1| unknown protein [Arabidopsis thaliana] gi|16648720|gb|AAL25552.1| AT4g21620/F17L22_80 [Arabidopsis thaliana] gi|21553868|gb|AAM62961.1| unknown [Arabidopsis thaliana] gi|110742179|dbj|BAE99017.1| hypothetical protein [Arabidopsis thaliana] gi|332659081|gb|AEE84481.1| glycine-rich protein [Arabidopsis thaliana] Length = 131 Score = 60.1 bits (144), Expect = 5e-07 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -1 Query: 416 VIRPVVTCKIKGPCYGKKLRCPAKCFTSWSXXXXXXXXXXXXXGCSMD 273 V+RP VTCK KGPC GKKLRCPAKCF S+S GC+MD Sbjct: 75 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMD 122 >ref|XP_002521418.1| nucleic acid binding protein, putative [Ricinus communis] gi|223539317|gb|EEF40908.1| nucleic acid binding protein, putative [Ricinus communis] Length = 147 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = -1 Query: 416 VIRPVVTCKIKGPCYGKKLRCPAKCFTSWSXXXXXXXXXXXXXGCSMD 273 +IRP V CK KGPCY KKL CPAKCFTS+S GC+MD Sbjct: 91 IIRPTVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTMD 138