BLASTX nr result
ID: Angelica22_contig00009004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00009004 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL32632.1| oxidoreductase of zinc-binding dehydrogenase fami... 102 4e-20 ref|NP_974388.1| putative trans-2-enoyl-CoA reductase [Arabidops... 102 4e-20 emb|CAB75790.1| nuclear receptor binding factor-like protein [Ar... 102 4e-20 ref|NP_566881.1| putative trans-2-enoyl-CoA reductase [Arabidops... 102 4e-20 ref|XP_002877434.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 101 7e-20 >gb|AAL32632.1| oxidoreductase of zinc-binding dehydrogenase family [Arabidopsis thaliana] gi|21387141|gb|AAM47974.1| oxidoreductase of zinc-binding dehydrogenase family [Arabidopsis thaliana] Length = 375 Score = 102 bits (253), Expect = 4e-20 Identities = 45/59 (76%), Positives = 55/59 (93%) Frame = +1 Query: 1 QSVWHKVDKGTPVEYAATVFINPLTALKMLEDFVDLNGGDSIVQNGATSMVGQCIIQLA 177 +SVWHK+DK P+EYAAT+ +NPLTAL+MLEDFV+LN GDS+VQNGATS+VGQC+IQLA Sbjct: 148 ESVWHKIDKECPMEYAATITVNPLTALRMLEDFVNLNSGDSVVQNGATSIVGQCVIQLA 206 >ref|NP_974388.1| putative trans-2-enoyl-CoA reductase [Arabidopsis thaliana] gi|332644549|gb|AEE78070.1| putative trans-2-enoyl-CoA reductase [Arabidopsis thaliana] Length = 297 Score = 102 bits (253), Expect = 4e-20 Identities = 45/59 (76%), Positives = 55/59 (93%) Frame = +1 Query: 1 QSVWHKVDKGTPVEYAATVFINPLTALKMLEDFVDLNGGDSIVQNGATSMVGQCIIQLA 177 +SVWHK+DK P+EYAAT+ +NPLTAL+MLEDFV+LN GDS+VQNGATS+VGQC+IQLA Sbjct: 70 ESVWHKIDKECPMEYAATITVNPLTALRMLEDFVNLNSGDSVVQNGATSIVGQCVIQLA 128 >emb|CAB75790.1| nuclear receptor binding factor-like protein [Arabidopsis thaliana] Length = 367 Score = 102 bits (253), Expect = 4e-20 Identities = 45/59 (76%), Positives = 55/59 (93%) Frame = +1 Query: 1 QSVWHKVDKGTPVEYAATVFINPLTALKMLEDFVDLNGGDSIVQNGATSMVGQCIIQLA 177 +SVWHK+DK P+EYAAT+ +NPLTAL+MLEDFV+LN GDS+VQNGATS+VGQC+IQLA Sbjct: 148 ESVWHKIDKECPMEYAATITVNPLTALRMLEDFVNLNSGDSVVQNGATSIVGQCVIQLA 206 >ref|NP_566881.1| putative trans-2-enoyl-CoA reductase [Arabidopsis thaliana] gi|62900587|sp|Q8LCU7.1|MECR_ARATH RecName: Full=Probable trans-2-enoyl-CoA reductase, mitochondrial; Flags: Precursor gi|21592515|gb|AAM64465.1| nuclear receptor binding factor-like protein [Arabidopsis thaliana] gi|332644550|gb|AEE78071.1| putative trans-2-enoyl-CoA reductase [Arabidopsis thaliana] Length = 375 Score = 102 bits (253), Expect = 4e-20 Identities = 45/59 (76%), Positives = 55/59 (93%) Frame = +1 Query: 1 QSVWHKVDKGTPVEYAATVFINPLTALKMLEDFVDLNGGDSIVQNGATSMVGQCIIQLA 177 +SVWHK+DK P+EYAAT+ +NPLTAL+MLEDFV+LN GDS+VQNGATS+VGQC+IQLA Sbjct: 148 ESVWHKIDKECPMEYAATITVNPLTALRMLEDFVNLNSGDSVVQNGATSIVGQCVIQLA 206 >ref|XP_002877434.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297323272|gb|EFH53693.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 376 Score = 101 bits (251), Expect = 7e-20 Identities = 45/59 (76%), Positives = 54/59 (91%) Frame = +1 Query: 1 QSVWHKVDKGTPVEYAATVFINPLTALKMLEDFVDLNGGDSIVQNGATSMVGQCIIQLA 177 +SVWHK+DK P+EYAAT+ +NPLTAL+MLEDFV LN GDS+VQNGATS+VGQC+IQLA Sbjct: 149 ESVWHKIDKACPMEYAATITVNPLTALRMLEDFVVLNSGDSVVQNGATSIVGQCVIQLA 207