BLASTX nr result
ID: Angelica22_contig00008940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008940 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589765.1| Pentatricopeptide repeat-containing protein ... 129 2e-28 ref|XP_003549481.1| PREDICTED: pentatricopeptide repeat-containi... 127 7e-28 ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 tpg|DAA36302.1| TPA: hypothetical protein ZEAMMB73_369042 [Zea m... 118 4e-25 ref|NP_001159140.1| hypothetical protein [Zea mays] gi|223942207... 118 4e-25 >ref|XP_003589765.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478813|gb|AES60016.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 960 Score = 129 bits (324), Expect = 2e-28 Identities = 61/84 (72%), Positives = 67/84 (79%), Gaps = 1/84 (1%) Frame = -1 Query: 341 GKY-TNEIGDTRPMSYHSEKIAVAYGLLTLPPWMPIHVMKNLRICRDCHLVMKLTSLVMS 165 GKY T E R YHSEK+A A+GLL LP WMPIHVMKNLR+C DCHLV+KL SLV S Sbjct: 791 GKYITVESSVHRSKKYHSEKLAFAFGLLNLPSWMPIHVMKNLRVCDDCHLVIKLLSLVTS 850 Query: 164 RELIVRDANRFHHFKDGVCSCKDY 93 RELI+RD RFHHFKDG+CSCKDY Sbjct: 851 RELIMRDGYRFHHFKDGICSCKDY 874 >ref|XP_003549481.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Glycine max] Length = 836 Score = 127 bits (320), Expect = 7e-28 Identities = 57/85 (67%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Frame = -1 Query: 341 GKYTNEIGDT-RPMSYHSEKIAVAYGLLTLPPWMPIHVMKNLRICRDCHLVMKLTSLVMS 165 G+Y + + R YHSEK+A A+GLL+LPPWMPI V KNLR+C DCHLV+KL SLV S Sbjct: 752 GRYVSIVSCAHRSQKYHSEKLAFAFGLLSLPPWMPIQVTKNLRVCNDCHLVIKLLSLVTS 811 Query: 164 RELIVRDANRFHHFKDGVCSCKDYW 90 RELI+RD RFHHFKDG CSC+DYW Sbjct: 812 RELIMRDGFRFHHFKDGFCSCRDYW 836 >ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Glycine max] Length = 711 Score = 119 bits (297), Expect = 3e-25 Identities = 52/75 (69%), Positives = 60/75 (80%) Frame = -1 Query: 314 TRPMSYHSEKIAVAYGLLTLPPWMPIHVMKNLRICRDCHLVMKLTSLVMSRELIVRDANR 135 T + YHSEK+AVAYGLL +P MPI VMKNLR+C DCH +KL + V RE+I+RDANR Sbjct: 637 THSLGYHSEKLAVAYGLLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANR 696 Query: 134 FHHFKDGVCSCKDYW 90 FHHFKDG CSCKDYW Sbjct: 697 FHHFKDGHCSCKDYW 711 >tpg|DAA36302.1| TPA: hypothetical protein ZEAMMB73_369042 [Zea mays] Length = 865 Score = 118 bits (296), Expect = 4e-25 Identities = 51/75 (68%), Positives = 59/75 (78%) Frame = -1 Query: 314 TRPMSYHSEKIAVAYGLLTLPPWMPIHVMKNLRICRDCHLVMKLTSLVMSRELIVRDANR 135 TR +HSEK+AVA+GL+TLP WMPIH+MKNLRIC DCH V+KL S V RE ++RDA R Sbjct: 791 TRSEIHHSEKLAVAFGLMTLPTWMPIHIMKNLRICGDCHTVIKLISTVTGREFVIRDAVR 850 Query: 134 FHHFKDGVCSCKDYW 90 FHHF G CSC DYW Sbjct: 851 FHHFNGGSCSCGDYW 865 >ref|NP_001159140.1| hypothetical protein [Zea mays] gi|223942207|gb|ACN25187.1| unknown [Zea mays] gi|414585730|tpg|DAA36301.1| TPA: hypothetical protein ZEAMMB73_369042 [Zea mays] Length = 885 Score = 118 bits (296), Expect = 4e-25 Identities = 51/75 (68%), Positives = 59/75 (78%) Frame = -1 Query: 314 TRPMSYHSEKIAVAYGLLTLPPWMPIHVMKNLRICRDCHLVMKLTSLVMSRELIVRDANR 135 TR +HSEK+AVA+GL+TLP WMPIH+MKNLRIC DCH V+KL S V RE ++RDA R Sbjct: 811 TRSEIHHSEKLAVAFGLMTLPTWMPIHIMKNLRICGDCHTVIKLISTVTGREFVIRDAVR 870 Query: 134 FHHFKDGVCSCKDYW 90 FHHF G CSC DYW Sbjct: 871 FHHFNGGSCSCGDYW 885