BLASTX nr result
ID: Angelica22_contig00008892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008892 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275626.1| PREDICTED: tryptophanyl-tRNA synthetase, cyt... 66 3e-09 emb|CAN66126.1| hypothetical protein VITISV_027725 [Vitis vinifera] 66 3e-09 ref|XP_004142265.1| PREDICTED: tryptophan--tRNA ligase, cytoplas... 64 2e-08 ref|NP_974219.1| tryptophanyl-tRNA synthetase [Arabidopsis thali... 62 4e-08 ref|NP_187110.1| tryptophanyl-tRNA synthetase [Arabidopsis thali... 62 4e-08 >ref|XP_002275626.1| PREDICTED: tryptophanyl-tRNA synthetase, cytoplasmic [Vitis vinifera] gi|302143316|emb|CBI21877.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 383 TDIVERHRKARAAVTDEMVDAFMAVRPLPNMFN 285 T++VERHR+ARAAVTDEMVDAFMAVRPLPNMFN Sbjct: 367 TELVERHRRARAAVTDEMVDAFMAVRPLPNMFN 399 >emb|CAN66126.1| hypothetical protein VITISV_027725 [Vitis vinifera] Length = 399 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 383 TDIVERHRKARAAVTDEMVDAFMAVRPLPNMFN 285 T++VERHR+ARAAVTDEMVDAFMAVRPLPNMFN Sbjct: 367 TELVERHRRARAAVTDEMVDAFMAVRPLPNMFN 399 >ref|XP_004142265.1| PREDICTED: tryptophan--tRNA ligase, cytoplasmic-like [Cucumis sativus] Length = 405 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 383 TDIVERHRKARAAVTDEMVDAFMAVRPLPNMFN 285 T++VERHR+ARAAVTDEMVDAFMAVRPLPNMF+ Sbjct: 373 TEMVERHRRARAAVTDEMVDAFMAVRPLPNMFD 405 >ref|NP_974219.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|332640583|gb|AEE74104.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana] Length = 402 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 383 TDIVERHRKARAAVTDEMVDAFMAVRPLPNMF 288 T+IVERHR+ARAAVTDEMVDAFMAVRPLP+MF Sbjct: 370 TEIVERHRRARAAVTDEMVDAFMAVRPLPSMF 401 >ref|NP_187110.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|145331754|ref|NP_001078104.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|6175164|gb|AAF04890.1|AC011437_5 putative tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|19310593|gb|AAL85027.1| putative tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|21436361|gb|AAM51350.1| putative tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|110740619|dbj|BAE98413.1| putative tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|332640582|gb|AEE74103.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana] gi|332640584|gb|AEE74105.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana] Length = 402 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 383 TDIVERHRKARAAVTDEMVDAFMAVRPLPNMF 288 T+IVERHR+ARAAVTDEMVDAFMAVRPLP+MF Sbjct: 370 TEIVERHRRARAAVTDEMVDAFMAVRPLPSMF 401