BLASTX nr result
ID: Angelica22_contig00008881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008881 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW69793.1| Hop-interacting protein THI030 [Solanum lycopersi... 77 1e-12 ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251... 76 3e-12 ref|XP_002881347.1| PTAC12 [Arabidopsis lyrata subsp. lyrata] gi... 74 1e-11 ref|XP_002531051.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 dbj|BAC42455.2| unknown protein [Arabidopsis thaliana] 72 4e-11 >gb|AEW69793.1| Hop-interacting protein THI030 [Solanum lycopersicum] Length = 528 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +1 Query: 1 RNWSVLKNTSELRKTKEKPKKNGMSLDKAIDDSENITDFLMDFDEDE 141 RNWSVLK+ EL K+K KPKK MSL++A+DDSEN+TDFLMDFDEDE Sbjct: 482 RNWSVLKSNPELSKSKGKPKKKDMSLEEAVDDSENLTDFLMDFDEDE 528 >ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251522 [Vitis vinifera] gi|297740769|emb|CBI30951.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/48 (70%), Positives = 45/48 (93%), Gaps = 1/48 (2%) Frame = +1 Query: 1 RNWSVLKNTSELRKTKEKPKKNG-MSLDKAIDDSENITDFLMDFDEDE 141 RNWSVLK+T +LRK+K+KPKK G MS+++A+DDSEN+TDFL+DF+EDE Sbjct: 465 RNWSVLKSTPQLRKSKDKPKKEGPMSVEEAVDDSENLTDFLLDFEEDE 512 >ref|XP_002881347.1| PTAC12 [Arabidopsis lyrata subsp. lyrata] gi|297327186|gb|EFH57606.1| PTAC12 [Arabidopsis lyrata subsp. lyrata] Length = 527 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = +1 Query: 1 RNWSVLKNTSELRKTKEKPKKNG-MSLDKAIDDSENITDFLMDFDED 138 RNWSVLK+T ELR K KPKK G MSLD+A+DDSEN+TDFLMDF+E+ Sbjct: 478 RNWSVLKSTPELRTAKPKPKKEGRMSLDEAVDDSENLTDFLMDFEEE 524 >ref|XP_002531051.1| conserved hypothetical protein [Ricinus communis] gi|223529346|gb|EEF31312.1| conserved hypothetical protein [Ricinus communis] Length = 524 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/48 (72%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = +1 Query: 1 RNWSVLKNTSELRKTKEKPKKNG-MSLDKAIDDSENITDFLMDFDEDE 141 RNWSVLK+T +LRK+K KPKK+G MSL++AI+DSEN+TDFLMDF E+E Sbjct: 476 RNWSVLKSTPQLRKSKAKPKKDGGMSLEEAIEDSENLTDFLMDFGEEE 523 >dbj|BAC42455.2| unknown protein [Arabidopsis thaliana] Length = 527 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +1 Query: 1 RNWSVLKNTSELRKTKEKPKKNG-MSLDKAIDDSENITDFLMDFDED 138 RNWSVLK T ELR K KPKK G MSLD+A+DD+EN+TDFLMDF+E+ Sbjct: 478 RNWSVLKETPELRTAKPKPKKEGRMSLDEAVDDAENLTDFLMDFEEE 524