BLASTX nr result
ID: Angelica22_contig00008786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008786 (491 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532038.1| conserved hypothetical protein [Ricinus comm... 72 5e-11 ref|XP_002302041.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_003521294.1| PREDICTED: uncharacterized protein LOC100778... 71 8e-11 ref|NP_001235822.1| uncharacterized protein LOC100527164 [Glycin... 71 8e-11 gb|AFG65883.1| Pinus taeda anonymous locus 2_8751_01 genomic seq... 71 1e-10 >ref|XP_002532038.1| conserved hypothetical protein [Ricinus communis] gi|223528308|gb|EEF30354.1| conserved hypothetical protein [Ricinus communis] Length = 169 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = +2 Query: 317 SYSPTHVPRHNRYEMQKRHDWNTFGQYLKNYHHHGQSPMSMRRCSGSQVLDFLKYLDQ 490 S SP+ +RYE QKR DWNTFGQYLKN+ + P+S+ RCSG+ VL+FL+YLDQ Sbjct: 37 SSSPSSSSTPSRYENQKRRDWNTFGQYLKNH----RPPLSLSRCSGAHVLEFLRYLDQ 90 >ref|XP_002302041.1| predicted protein [Populus trichocarpa] gi|222843767|gb|EEE81314.1| predicted protein [Populus trichocarpa] Length = 149 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = +2 Query: 317 SYSPTHVPRHNRYEMQKRHDWNTFGQYLKNYHHHGQSPMSMRRCSGSQVLDFLKYLDQ 490 S SP+ +RYE QKR DWNTFGQYLKN+ + P+S+ RCSG+ VL+FL+YLDQ Sbjct: 6 SSSPSSSTAPSRYENQKRRDWNTFGQYLKNH----RPPLSLSRCSGAHVLEFLRYLDQ 59 >ref|XP_003521294.1| PREDICTED: uncharacterized protein LOC100778283 [Glycine max] Length = 203 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = +2 Query: 317 SYSPTHVPRHNRYEMQKRHDWNTFGQYLKNYHHHGQSPMSMRRCSGSQVLDFLKYLDQ 490 S + T + +RYE QKR DWNTFGQYLKN+ + P+S+ RCSG+ VL+FL+YLDQ Sbjct: 38 SPASTSITSSSRYENQKRRDWNTFGQYLKNH----RPPLSLSRCSGAHVLEFLRYLDQ 91 >ref|NP_001235822.1| uncharacterized protein LOC100527164 [Glycine max] gi|255631694|gb|ACU16214.1| unknown [Glycine max] Length = 203 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = +2 Query: 317 SYSPTHVPRHNRYEMQKRHDWNTFGQYLKNYHHHGQSPMSMRRCSGSQVLDFLKYLDQ 490 S + T + +RYE QKR DWNTFGQYLKN+ + P+S+ RCSG+ VL+FL+YLDQ Sbjct: 38 SPASTSITSSSRYENQKRRDWNTFGQYLKNH----RPPLSLSRCSGAHVLEFLRYLDQ 91 >gb|AFG65883.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165944|gb|AFG65884.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165945|gb|AFG65885.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165946|gb|AFG65886.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165947|gb|AFG65887.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165948|gb|AFG65888.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165949|gb|AFG65889.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165950|gb|AFG65890.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165951|gb|AFG65891.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165952|gb|AFG65892.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165953|gb|AFG65893.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165954|gb|AFG65894.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165955|gb|AFG65895.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165956|gb|AFG65896.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165957|gb|AFG65897.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165958|gb|AFG65898.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165959|gb|AFG65899.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165960|gb|AFG65900.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence Length = 134 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = +2 Query: 317 SYSPTHVPRHNRYEMQKRHDWNTFGQYLKNYHHHGQSPMSMRRCSGSQVLDFLKYLDQ 490 S P+ VP +RYE QKR DWNTFGQYLKN+ + P+++ RCSG+ VL+FL+YLDQ Sbjct: 27 SREPSTVP--SRYESQKRRDWNTFGQYLKNH----RPPLALSRCSGAHVLEFLRYLDQ 78