BLASTX nr result
ID: Angelica22_contig00008693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008693 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27208.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vi... 64 1e-08 ref|XP_002534450.1| Thioredoxin I, putative [Ricinus communis] g... 63 2e-08 dbj|BAK01566.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 1e-07 ref|XP_003563361.1| PREDICTED: thioredoxin O, mitochondrial-like... 60 2e-07 >emb|CBI27208.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 423 LGNVLSELDINSVPTLHFFHNGEKASEVVGADLQRIRDTMENLYK 289 L N L L+I SVPTLHFF NG+KA+E++GAD+ R++DTM+ LYK Sbjct: 162 LENTLRRLNIASVPTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 206 >ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vitis vinifera] gi|359473079|ref|XP_003631244.1| PREDICTED: thioredoxin O1, mitochondrial-like [Vitis vinifera] gi|297738008|emb|CBI27209.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 423 LGNVLSELDINSVPTLHFFHNGEKASEVVGADLQRIRDTMENLYK 289 L N L L+I SVPTLHFF NG+KA+E++GAD+ R++DTM+ LYK Sbjct: 140 LENTLRRLNIASVPTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 184 >ref|XP_002534450.1| Thioredoxin I, putative [Ricinus communis] gi|223525268|gb|EEF27933.1| Thioredoxin I, putative [Ricinus communis] Length = 206 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = -1 Query: 423 LGNVLSELDINSVPTLHFFHNGEKASEVVGADLQRIRDTMENLY 292 L + L++L I++VPTLHFF NG+KA+E+VGAD++RI+DTME LY Sbjct: 160 LRSKLNQLFISAVPTLHFFQNGKKAAEIVGADVERIKDTMEELY 203 >dbj|BAK01566.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 179 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -1 Query: 423 LGNVLSELDINSVPTLHFFHNGEKASEVVGADLQRIRDTMENLYK 289 LGN LS L I S+PT HF+H GEK+SEVVGAD++++ ME+L+K Sbjct: 133 LGNRLSNLKICSIPTFHFYHKGEKSSEVVGADVKKLEAAMESLHK 177 >ref|XP_003563361.1| PREDICTED: thioredoxin O, mitochondrial-like [Brachypodium distachyon] Length = 176 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 420 GNVLSELDINSVPTLHFFHNGEKASEVVGADLQRIRDTMENLYK 289 GN LS+L I SVPT HF+H GEK SEVVGAD++++ ME+L+K Sbjct: 131 GNKLSDLKIFSVPTFHFYHKGEKTSEVVGADVKKLEVAMESLHK 174