BLASTX nr result
ID: Angelica22_contig00008640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008640 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota] 101 5e-20 gb|ADC94856.1| DRE transcription factor 1 [Vitis pseudoreticulata] 63 2e-08 ref|XP_002533146.1| DNA binding protein, putative [Ricinus commu... 62 6e-08 ref|XP_002263305.2| PREDICTED: ethylene-responsive transcription... 61 8e-08 ref|XP_003635449.1| PREDICTED: ethylene-responsive transcription... 60 2e-07 >dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota] Length = 320 Score = 101 bits (252), Expect = 5e-20 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +1 Query: 1 FYYPFDTSFSTQPTIFPGYSPPESTTQMFSNGFSGFTQMGIDQTGSLGLNQLTPS 165 FYYPFD+SFSTQP FP YSPPESTTQMFS GFSGF MG+DQTGSLGLNQ+TPS Sbjct: 48 FYYPFDSSFSTQPPTFPVYSPPESTTQMFSTGFSGFAHMGMDQTGSLGLNQITPS 102 >gb|ADC94856.1| DRE transcription factor 1 [Vitis pseudoreticulata] Length = 379 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +1 Query: 1 FYYPFDTSFSTQPTIFPGYSPPESTTQMFSNGFSGFTQMGIDQTGSLGLNQLTPS 165 F YP D STQP ++PG+ STT MFS GF G+ QMG++QTGS+GLN +TP+ Sbjct: 63 FSYPPD---STQPNMYPGFCST-STTHMFSQGFLGYDQMGLEQTGSIGLNHITPA 113 >ref|XP_002533146.1| DNA binding protein, putative [Ricinus communis] gi|223527057|gb|EEF29242.1| DNA binding protein, putative [Ricinus communis] Length = 374 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = +1 Query: 1 FYYPFDTSF-STQPTIFPGYSPPESTTQMFSNGFSGFTQMGIDQTGSLGLNQLTPS 165 FY+P S+ S+ PT++P + P ST +FS GFSG+ Q+G +QTGS+GLN LTPS Sbjct: 67 FYFPSYPSYDSSIPTMYPDFCSPLST-HLFSQGFSGYNQLGFEQTGSIGLNHLTPS 121 >ref|XP_002263305.2| PREDICTED: ethylene-responsive transcription factor RAP2-4-like, partial [Vitis vinifera] Length = 290 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = +1 Query: 1 FYYPFDTSFSTQPTIFPGYSPPESTTQMFSNGFSGFTQMGIDQTGSLGLNQLTPS 165 F YP D STQP ++P + STT +FS GFSG+ QMG++QTGS+GLN +TP+ Sbjct: 63 FSYPPD---STQPNMYPDFCST-STTHVFSQGFSGYDQMGLEQTGSIGLNHITPA 113 >ref|XP_003635449.1| PREDICTED: ethylene-responsive transcription factor RAP2-4-like [Vitis vinifera] Length = 374 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = +1 Query: 1 FYYPFDTSFSTQPTIFPGYSPPESTTQMFSNGFSGFTQMGIDQTGSLGLNQLTPS 165 F YP D STQP ++P + STT MFS GFSG+ QMG++QT S+GLN +TP+ Sbjct: 63 FSYPPD---STQPNMYPDFCST-STTHMFSQGFSGYDQMGLEQTRSIGLNHITPA 113