BLASTX nr result
ID: Angelica22_contig00008266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008266 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280759.1| PREDICTED: pyrrolidone-carboxylate peptidase... 55 6e-06 ref|NP_001235980.1| uncharacterized protein LOC100305735 [Glycin... 55 8e-06 >ref|XP_002280759.1| PREDICTED: pyrrolidone-carboxylate peptidase isoform 1 [Vitis vinifera] Length = 219 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -3 Query: 223 ILSLFVHVPSFSTIDVETQMQFAASLLEVLASTN 122 I SLFVHVP F TID ETQMQFAASLLEVLAS N Sbjct: 186 IQSLFVHVPLFLTIDEETQMQFAASLLEVLASLN 219 >ref|NP_001235980.1| uncharacterized protein LOC100305735 [Glycine max] gi|255626473|gb|ACU13581.1| unknown [Glycine max] Length = 224 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 217 SLFVHVPSFSTIDVETQMQFAASLLEVLAST 125 SLFVHVP FSTI+ ETQMQFAASLLEVLAST Sbjct: 192 SLFVHVPLFSTINEETQMQFAASLLEVLAST 222