BLASTX nr result
ID: Angelica22_contig00008257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00008257 (487 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318260.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|XP_002461615.1| hypothetical protein SORBIDRAFT_02g005470 [S... 62 6e-08 emb|CBI31873.3| unnamed protein product [Vitis vinifera] 61 8e-08 emb|CBI24459.3| unnamed protein product [Vitis vinifera] 61 8e-08 ref|XP_002264496.1| PREDICTED: cucumisin-like [Vitis vinifera] 61 8e-08 >ref|XP_002318260.1| predicted protein [Populus trichocarpa] gi|222858933|gb|EEE96480.1| predicted protein [Populus trichocarpa] Length = 772 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -2 Query: 486 GVVSVFPNRKLQIHTTRSWDFLGVPRSDPLKPAEGCVIVGMLDT 355 GVVSVFPN +LQ+HTTRSWDF+G+P S P AEG VIVG+LDT Sbjct: 74 GVVSVFPNAQLQVHTTRSWDFMGLPESHPRLSAEGDVIVGLLDT 117 >ref|XP_002461615.1| hypothetical protein SORBIDRAFT_02g005470 [Sorghum bicolor] gi|241924992|gb|EER98136.1| hypothetical protein SORBIDRAFT_02g005470 [Sorghum bicolor] Length = 944 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/46 (69%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -2 Query: 486 GVVSVFPNRKLQIHTTRSWDFLGVPRS--DPLKPAEGCVIVGMLDT 355 GVVSVFP+R L + TTRSWDFLG P+S + L P EG VIVGMLDT Sbjct: 302 GVVSVFPSRTLDLLTTRSWDFLGFPQSPFEELLPLEGDVIVGMLDT 347 >emb|CBI31873.3| unnamed protein product [Vitis vinifera] Length = 751 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 486 GVVSVFPNRKLQIHTTRSWDFLGVPRSDPLKPAEGCVIVGMLDT 355 GVVSVFPN K+Q+HTTRSWDF+ P P+ EG VI+GMLDT Sbjct: 112 GVVSVFPNTKVQLHTTRSWDFMSFP-EPPMGSYEGDVIIGMLDT 154 >emb|CBI24459.3| unnamed protein product [Vitis vinifera] Length = 736 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 486 GVVSVFPNRKLQIHTTRSWDFLGVPRSDPLKPAEGCVIVGMLDT 355 GVVSVFPN K+Q+HTTRSWDF+ P P+ EG VI+GMLDT Sbjct: 60 GVVSVFPNTKVQLHTTRSWDFMSFP-EPPMGSYEGDVIIGMLDT 102 >ref|XP_002264496.1| PREDICTED: cucumisin-like [Vitis vinifera] Length = 773 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 486 GVVSVFPNRKLQIHTTRSWDFLGVPRSDPLKPAEGCVIVGMLDT 355 GVVSVFPN K+Q+HTTRSWDF+ P P+ EG VI+GMLDT Sbjct: 97 GVVSVFPNTKVQLHTTRSWDFMSFP-EPPMGSYEGDVIIGMLDT 139