BLASTX nr result
ID: Angelica22_contig00007275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00007275 (718 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB69317.1| plastidic glucose-6-phosphate dehydrogenase [Petr... 83 5e-14 gb|AEZ51836.1| glucose-6-phosphate dehydrogenase [Fragaria x ana... 70 4e-10 ref|XP_002297854.1| predicted protein [Populus trichocarpa] gi|2... 70 4e-10 gb|AAL57678.1| AT5g13110/T19L5_70 [Arabidopsis thaliana] 69 7e-10 gb|AAM98087.1| At1g24280/F3I6_22 [Arabidopsis thaliana] gi|27764... 69 7e-10 >gb|AAB69317.1| plastidic glucose-6-phosphate dehydrogenase [Petroselinum crispum] Length = 604 Score = 83.2 bits (204), Expect = 5e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 717 KKTVPEYYPYGSRGPVGAHYLAAKYKVRWGDFAGDQ 610 KKTVPEYYPYGSRGPVGAHYLAAKYKVRWGDFAGDQ Sbjct: 569 KKTVPEYYPYGSRGPVGAHYLAAKYKVRWGDFAGDQ 604 >gb|AEZ51836.1| glucose-6-phosphate dehydrogenase [Fragaria x ananassa] Length = 594 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 717 KKTVPEYYPYGSRGPVGAHYLAAKYKVRWGDFAGDQ 610 KK +PEYYPYGSRGPVGAHYLAA+YKVRWGD +Q Sbjct: 559 KKIIPEYYPYGSRGPVGAHYLAARYKVRWGDVGVEQ 594 >ref|XP_002297854.1| predicted protein [Populus trichocarpa] gi|222845112|gb|EEE82659.1| predicted protein [Populus trichocarpa] Length = 603 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 717 KKTVPEYYPYGSRGPVGAHYLAAKYKVRWGDFAGDQ 610 KK +PEYYPYGSRGPVGAHYLAA+YKVRWGD +Q Sbjct: 568 KKIIPEYYPYGSRGPVGAHYLAARYKVRWGDLGIEQ 603 >gb|AAL57678.1| AT5g13110/T19L5_70 [Arabidopsis thaliana] Length = 596 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 717 KKTVPEYYPYGSRGPVGAHYLAAKYKVRWGDFAGDQ 610 KK +PEYYPYGSRGPVGAHYLAAK+KV+WGD + DQ Sbjct: 561 KKRIPEYYPYGSRGPVGAHYLAAKHKVQWGDVSIDQ 596 >gb|AAM98087.1| At1g24280/F3I6_22 [Arabidopsis thaliana] gi|27764952|gb|AAO23597.1| At1g24280/F3I6_22 [Arabidopsis thaliana] Length = 599 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 717 KKTVPEYYPYGSRGPVGAHYLAAKYKVRWGDFAGDQ 610 KKT PE+YPYGSRGPVGAHYLAAK+KV+WGD + DQ Sbjct: 564 KKTTPEFYPYGSRGPVGAHYLAAKHKVQWGDLSLDQ 599