BLASTX nr result
ID: Angelica22_contig00007268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00007268 (808 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608047.1| Senescence-associated nodulin 1A [Medicago t... 87 2e-27 ref|XP_002330269.1| 2-oxoglutarate-dependent dioxygenase [Populu... 82 2e-27 ref|XP_002519156.1| Gibberellin 20 oxidase, putative [Ricinus co... 83 3e-27 ref|XP_004170640.1| PREDICTED: gibberellin 20 oxidase 1-like [Cu... 80 3e-26 ref|XP_004136997.1| PREDICTED: gibberellin 20 oxidase 1-like [Cu... 80 4e-26 >ref|XP_003608047.1| Senescence-associated nodulin 1A [Medicago truncatula] gi|355509102|gb|AES90244.1| Senescence-associated nodulin 1A [Medicago truncatula] Length = 351 Score = 86.7 bits (213), Expect(2) = 2e-27 Identities = 36/58 (62%), Positives = 48/58 (82%) Frame = +2 Query: 317 FLQSSHSTMVEPLNDLTDDENPPKYRAYNWGKFNMNRRRSNFKKLAVENIQIYHFKVS 490 F +H T+V+PL +LT++ENPPKYR YNWGKF +NR+ SNF+K VENIQIYH+K++ Sbjct: 294 FFFPAHDTVVKPLEELTNEENPPKYRPYNWGKFLVNRKSSNFEKKKVENIQIYHYKIA 351 Score = 62.8 bits (151), Expect(2) = 2e-27 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 237 VWSNDKYESVEHRVMVNSERERFSIPFFFNP 329 VWSND YESVEHRVMVNSE+ERFSIPFFF P Sbjct: 267 VWSNDAYESVEHRVMVNSEKERFSIPFFFFP 297 >ref|XP_002330269.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] gi|222871304|gb|EEF08435.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] Length = 369 Score = 81.6 bits (200), Expect(2) = 2e-27 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = +2 Query: 317 FLQSSHSTMVEPLNDLTDDENPPKYRAYNWGKFNMNRRRSNFKKLAVENIQIYHFKV 487 F +H T V+PL +LT+++NP +Y+ YNWGKF + R+RSNFKKL VENIQIYHF++ Sbjct: 297 FFNPAHYTDVKPLEELTNEQNPVRYKPYNWGKFFVTRKRSNFKKLDVENIQIYHFRI 353 Score = 67.4 bits (163), Expect(2) = 2e-27 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 237 VWSNDKYESVEHRVMVNSERERFSIPFFFNP 329 VWSND YESVEHRVMVNSERERFSIPFFFNP Sbjct: 270 VWSNDAYESVEHRVMVNSERERFSIPFFFNP 300 >ref|XP_002519156.1| Gibberellin 20 oxidase, putative [Ricinus communis] gi|223541819|gb|EEF43367.1| Gibberellin 20 oxidase, putative [Ricinus communis] Length = 363 Score = 83.2 bits (204), Expect(2) = 3e-27 Identities = 34/58 (58%), Positives = 46/58 (79%) Frame = +2 Query: 317 FLQSSHSTMVEPLNDLTDDENPPKYRAYNWGKFNMNRRRSNFKKLAVENIQIYHFKVS 490 F +H TMV+PL ++ D++NP KY+ Y+WGKF + R+RSNFKKL EN+QIYHF+VS Sbjct: 299 FFNPAHYTMVKPLEEILDEQNPAKYKPYSWGKFLVTRKRSNFKKLDAENVQIYHFRVS 356 Score = 65.1 bits (157), Expect(2) = 3e-27 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 237 VWSNDKYESVEHRVMVNSERERFSIPFFFNP 329 VWSND YESVEHRV VNSERERFSIPFFFNP Sbjct: 272 VWSNDAYESVEHRVKVNSERERFSIPFFFNP 302 >ref|XP_004170640.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis sativus] Length = 207 Score = 80.5 bits (197), Expect(2) = 3e-26 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = +2 Query: 317 FLQSSHSTMVEPLNDLTDDENPPKYRAYNWGKFNMNRRRSNFKKLAVENIQIYHFKVS 490 F SHST+VEPL +L D +NPPKY++Y++GKF NR+RSNFKKL +NIQI FK++ Sbjct: 149 FFNPSHSTIVEPLKELVDSQNPPKYKSYSYGKFLTNRQRSNFKKLNTDNIQISDFKIT 206 Score = 64.7 bits (156), Expect(2) = 3e-26 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 237 VWSNDKYESVEHRVMVNSERERFSIPFFFNP 329 VWSN+KYESVEHRVMVNSE++R+SIPFFFNP Sbjct: 122 VWSNEKYESVEHRVMVNSEKDRYSIPFFFNP 152 >ref|XP_004136997.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis sativus] Length = 350 Score = 80.1 bits (196), Expect(2) = 4e-26 Identities = 34/58 (58%), Positives = 46/58 (79%) Frame = +2 Query: 317 FLQSSHSTMVEPLNDLTDDENPPKYRAYNWGKFNMNRRRSNFKKLAVENIQIYHFKVS 490 F SHST+VEPL +L D +NPPKY++Y++GKF NR+RSNFKKL +N+QI FK++ Sbjct: 292 FFNPSHSTIVEPLKELVDSQNPPKYKSYSYGKFLTNRQRSNFKKLNTDNVQISDFKIT 349 Score = 64.7 bits (156), Expect(2) = 4e-26 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 237 VWSNDKYESVEHRVMVNSERERFSIPFFFNP 329 VWSN+KYESVEHRVMVNSE++R+SIPFFFNP Sbjct: 265 VWSNEKYESVEHRVMVNSEKDRYSIPFFFNP 295