BLASTX nr result
ID: Angelica22_contig00007205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00007205 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531120.1| r2r3-myb transcription factor, putative [Ric... 71 8e-11 ref|XP_002284400.1| PREDICTED: transcription factor MYB59-like [... 71 1e-10 ref|XP_002313452.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 gb|AAC83616.1| putative transcription factor [Arabidopsis thaliana] 70 2e-10 gb|AAY97896.1| MYB transcription factor MYB59-4 [Arabidopsis tha... 70 2e-10 >ref|XP_002531120.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223529316|gb|EEF31285.1| r2r3-myb transcription factor, putative [Ricinus communis] Length = 244 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 297 KMGQDEFRKGPWTEHEDVQLAFYVNLFGDRRWDFIAKVSGL 419 KM QDE RKGPWTE ED+ L +V+LFGDRRWDFIAKVSGL Sbjct: 2 KMMQDEIRKGPWTEQEDILLINFVHLFGDRRWDFIAKVSGL 42 >ref|XP_002284400.1| PREDICTED: transcription factor MYB59-like [Vitis vinifera] Length = 258 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +3 Query: 297 KMGQDEFRKGPWTEHEDVQLAFYVNLFGDRRWDFIAKVSGL 419 KM Q+E RKGPWTE ED QL +V LFGDRRWDFIAKVSGL Sbjct: 2 KMVQEEIRKGPWTEKEDFQLVCFVGLFGDRRWDFIAKVSGL 42 >ref|XP_002313452.1| predicted protein [Populus trichocarpa] gi|222849860|gb|EEE87407.1| predicted protein [Populus trichocarpa] Length = 228 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 300 MGQDEFRKGPWTEHEDVQLAFYVNLFGDRRWDFIAKVSGL 419 M QDE RKGPWTE ED+ L +VNLFGDRRWDFIAKVSGL Sbjct: 1 MMQDETRKGPWTEQEDILLINFVNLFGDRRWDFIAKVSGL 40 >gb|AAC83616.1| putative transcription factor [Arabidopsis thaliana] Length = 234 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +3 Query: 297 KMGQDEFRKGPWTEHEDVQLAFYVNLFGDRRWDFIAKVSGL 419 K+ Q+E+RKGPWTE ED+ L +V+LFGDRRWDF+AKVSGL Sbjct: 2 KLVQEEYRKGPWTEQEDILLVNFVHLFGDRRWDFVAKVSGL 42 >gb|AAY97896.1| MYB transcription factor MYB59-4 [Arabidopsis thaliana] Length = 85 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +3 Query: 297 KMGQDEFRKGPWTEHEDVQLAFYVNLFGDRRWDFIAKVSGL 419 K+ Q+E+RKGPWTE ED+ L +V+LFGDRRWDF+AKVSGL Sbjct: 2 KLVQEEYRKGPWTEQEDILLVNFVHLFGDRRWDFVAKVSGL 42