BLASTX nr result
ID: Angelica22_contig00006796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00006796 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003332850.1| hypothetical protein PGTG_14009 [Puccinia gr... 66 3e-09 ref|XP_003096970.1| hypothetical protein CRE_21455 [Caenorhabdit... 64 1e-08 ref|XP_003335986.1| hypothetical protein PGTG_17621 [Puccinia gr... 64 2e-08 ref|XP_003330247.1| hypothetical protein PGTG_11584 [Puccinia gr... 64 2e-08 ref|XP_002899681.1| helitron helicase-like protein [Phytophthora... 63 2e-08 >ref|XP_003332850.1| hypothetical protein PGTG_14009 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 1337 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 3/57 (5%) Frame = -2 Query: 162 IINNSYN---YSMMHVIEFQKRGLPHMHMLIWLHPNDRPNTIDQIDYLVSAEIPDKQ 1 I+N S+ +++H +EFQKRGLPH H+++ LHP+D P TI +D ++SAEIPD Q Sbjct: 517 IVNGSFLGRVAAVVHTVEFQKRGLPHAHIMVMLHPSDIPRTIAAVDSIISAEIPDPQ 573 >ref|XP_003096970.1| hypothetical protein CRE_21455 [Caenorhabditis remanei] gi|308241170|gb|EFO85122.1| hypothetical protein CRE_21455 [Caenorhabditis remanei] Length = 1493 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -2 Query: 132 MHVIEFQKRGLPHMHMLIWLHPNDRPNTIDQIDYLVSAEIPDK 4 ++VIEFQKRGLPHMHMLI + P +P T +D+++SAEIPDK Sbjct: 737 IYVIEFQKRGLPHMHMLIIMKPGSKPRTAADVDWIISAEIPDK 779 >ref|XP_003335986.1| hypothetical protein PGTG_17621 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 1098 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = -2 Query: 126 VIEFQKRGLPHMHMLIWLHPNDRPNTIDQIDYLVSAEIPDKQ 1 VIEFQKRGLPH H++++LHP+D P T++ I+ LV+AE+PD Q Sbjct: 335 VIEFQKRGLPHCHIMLFLHPDDVPRTVESINCLVTAEVPDPQ 376 >ref|XP_003330247.1| hypothetical protein PGTG_11584 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 1409 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -2 Query: 138 SMMHVIEFQKRGLPHMHMLIWLHPNDRPNTIDQIDYLVSAEIP 10 +++H +EFQKRGLPH H+++ LHP+D P TI +D L+SAEIP Sbjct: 466 AVVHTVEFQKRGLPHAHIMVMLHPSDVPRTISAVDSLISAEIP 508 >ref|XP_002899681.1| helitron helicase-like protein [Phytophthora infestans T30-4] gi|262102683|gb|EEY60735.1| helitron helicase-like protein [Phytophthora infestans T30-4] Length = 1861 Score = 63.2 bits (152), Expect = 2e-08 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = -2 Query: 132 MHVIEFQKRGLPHMHMLIWLHPNDRPNTIDQIDYLVSAEIPDKQ 1 +HV+E+QKRGLPH H+L+ L P D+P T + +D LVS+E+PDK+ Sbjct: 850 VHVVEYQKRGLPHAHILLILRPEDKPTTKEDVDKLVSSELPDKE 893