BLASTX nr result
ID: Angelica22_contig00006293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00006293 (1335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW86618.1| putative VHS/GAT domain containing family protein... 65 3e-08 gb|AFW86617.1| putative VHS/GAT domain containing family protein... 65 3e-08 ref|XP_002437041.1| hypothetical protein SORBIDRAFT_10g019670 [S... 65 3e-08 ref|NP_001151446.1| VHS and GAT domain protein [Zea mays] gi|195... 65 3e-08 ref|XP_003522697.1| PREDICTED: TOM1-like protein 1-like [Glycine... 64 7e-08 >gb|AFW86618.1| putative VHS/GAT domain containing family protein [Zea mays] Length = 671 Score = 65.5 bits (158), Expect = 3e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 1335 PDNHVREKILILIDSWKEAFGGATSRYPECFAAYEEML 1222 PD HV+EKILILID+W+EAFGGA +RYP+ +AAY+EML Sbjct: 95 PDYHVKEKILILIDTWQEAFGGARARYPQYYAAYQEML 132 >gb|AFW86617.1| putative VHS/GAT domain containing family protein [Zea mays] Length = 674 Score = 65.5 bits (158), Expect = 3e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 1335 PDNHVREKILILIDSWKEAFGGATSRYPECFAAYEEML 1222 PD HV+EKILILID+W+EAFGGA +RYP+ +AAY+EML Sbjct: 95 PDYHVKEKILILIDTWQEAFGGARARYPQYYAAYQEML 132 >ref|XP_002437041.1| hypothetical protein SORBIDRAFT_10g019670 [Sorghum bicolor] gi|241915264|gb|EER88408.1| hypothetical protein SORBIDRAFT_10g019670 [Sorghum bicolor] Length = 675 Score = 65.5 bits (158), Expect = 3e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 1335 PDNHVREKILILIDSWKEAFGGATSRYPECFAAYEEML 1222 PD HV+EKILILID+W+EAFGGA +RYP+ +AAY+EML Sbjct: 95 PDYHVKEKILILIDTWQEAFGGARARYPQYYAAYQEML 132 >ref|NP_001151446.1| VHS and GAT domain protein [Zea mays] gi|195646866|gb|ACG42901.1| VHS and GAT domain protein [Zea mays] Length = 672 Score = 65.5 bits (158), Expect = 3e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 1335 PDNHVREKILILIDSWKEAFGGATSRYPECFAAYEEML 1222 PD HV+EKILILID+W+EAFGGA +RYP+ +AAY+EML Sbjct: 95 PDYHVKEKILILIDTWQEAFGGARARYPQYYAAYQEML 132 >ref|XP_003522697.1| PREDICTED: TOM1-like protein 1-like [Glycine max] Length = 666 Score = 64.3 bits (155), Expect = 7e-08 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -1 Query: 1335 PDNHVREKILILIDSWKEAFGGATSRYPECFAAYEEML 1222 PD HVREKILILID+W+EAFGG+ +RYP+ +AAY+E+L Sbjct: 94 PDYHVREKILILIDTWQEAFGGSRARYPQYYAAYQELL 131