BLASTX nr result
ID: Angelica22_contig00006025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00006025 (512 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] 69 4e-10 >emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] Length = 115 Score = 68.9 bits (167), Expect = 4e-10 Identities = 39/92 (42%), Positives = 57/92 (61%), Gaps = 12/92 (13%) Frame = -2 Query: 469 ENMKDYVGEKLKEVLVFMQY-------RWDKLFPKPRETRADKLIRWIKVGTPFMITGLV 311 E++ +V EKLKE+LV ++ DK+F ++R +KL WI+VG PF+I GLV Sbjct: 4 ESVMKFVVEKLKELLVLLENFGGYLVDEVDKVFAP--DSRGEKLRHWIQVGAPFLILGLV 61 Query: 310 LLMLM-----CCSGRRSLRMMKVPGRNSRIPR 230 L++ CC GRR ++MMK PGR+ R+ R Sbjct: 62 LVVFYYCCCGCCRGRRGVKMMKAPGRDYRMAR 93