BLASTX nr result
ID: Angelica22_contig00005971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00005971 (680 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAL68173.1| ethylene response factor #229 [Nicotiana tabacum] 56 6e-06 gb|AAV54034.1| ethylene-responsive element binding protein 6 [Ni... 56 6e-06 >dbj|BAL68173.1| ethylene response factor #229 [Nicotiana tabacum] Length = 221 Score = 56.2 bits (134), Expect = 6e-06 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 3/64 (4%) Frame = -2 Query: 676 PFLDPRVFNPNFVQDNHLIASAQRPASSGMSSTLESFSGPKSVIVPQ---ITSRRFPRSR 506 PF+DPR+++ Q+NH I QRP SS MSST+ESFSGP+ Q + SR+ PRS Sbjct: 102 PFIDPRLYS----QENHPIV-IQRPTSSSMSSTVESFSGPRPPPRQQTAVLPSRKHPRSP 156 Query: 505 PILP 494 P++P Sbjct: 157 PVVP 160 >gb|AAV54034.1| ethylene-responsive element binding protein 6 [Nicotiana tabacum] Length = 244 Score = 56.2 bits (134), Expect = 6e-06 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 3/64 (4%) Frame = -2 Query: 676 PFLDPRVFNPNFVQDNHLIASAQRPASSGMSSTLESFSGPKSVIVPQ---ITSRRFPRSR 506 PF+DPR+++ Q+NH I QRP SS MSST+ESFSGP+ Q + SR+ PRS Sbjct: 101 PFIDPRLYS----QENHPIV-IQRPTSSSMSSTVESFSGPRPPPRQQTAVLPSRKHPRSP 155 Query: 505 PILP 494 P++P Sbjct: 156 PVVP 159