BLASTX nr result
ID: Angelica22_contig00005970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00005970 (671 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_175479.1| ethylene-responsive transcription factor 3 [Ara... 62 1e-07 ref|XP_002894264.1| ATERF3/ERF3 [Arabidopsis lyrata subsp. lyrat... 60 3e-07 emb|CBI26688.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_002278022.1| PREDICTED: ethylene-responsive transcription... 59 1e-06 dbj|BAL68169.1| ethylene response factor #205 [Nicotiana tabacum] 57 2e-06 >ref|NP_175479.1| ethylene-responsive transcription factor 3 [Arabidopsis thaliana] gi|7531109|sp|O80339.1|ERF82_ARATH RecName: Full=Ethylene-responsive transcription factor 3; Short=AtERF3; AltName: Full=Ethylene-responsive element-binding factor 3; Short=EREBP-3 gi|9454548|gb|AAF87871.1|AC012561_4 ethylene responsive element binding factor 3 [Arabidopsis thaliana] gi|12322345|gb|AAG51201.1|AC079279_22 ethylene responsive element binding factor 3 (ERF3) [Arabidopsis thaliana] gi|3434971|dbj|BAA32420.1| ethylene responsive element binding factor 3 [Arabidopsis thaliana] gi|94442521|gb|ABF19048.1| At1g50640 [Arabidopsis thaliana] gi|225898020|dbj|BAH30342.1| hypothetical protein [Arabidopsis thaliana] gi|332194453|gb|AEE32574.1| ethylene-responsive transcription factor 3 [Arabidopsis thaliana] Length = 225 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +2 Query: 5 PFLDPRFFNPNL--IASAQRPASSGMSSTLESFSGPKSTIVPPITSRRFPRSPPILP 169 PF+D R F + RP SS MSST+ESFSGP+ T + P T++R+PR+PP++P Sbjct: 110 PFMDHRLFTDHQQQFPIVNRPTSSSMSSTVESFSGPRPTTMKPATTKRYPRTPPVVP 166 >ref|XP_002894264.1| ATERF3/ERF3 [Arabidopsis lyrata subsp. lyrata] gi|297340106|gb|EFH70523.1| ATERF3/ERF3 [Arabidopsis lyrata subsp. lyrata] Length = 224 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +2 Query: 5 PFLDPRFF--NPNLIASAQRPASSGMSSTLESFSGPKSTIVPPITSRRFPRSPPILP 169 PF+D R + + RP SS MSST+ESFSGP+ T + P T++R+PR+PP++P Sbjct: 109 PFMDHRLYADHQQQFPIVNRPTSSSMSSTVESFSGPRPTTMKPATTKRYPRTPPVVP 165 >emb|CBI26688.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +2 Query: 50 AQRPASSGMSSTLESFSGPK--STIVPPITSRRFPRSPPILP 169 AQRP SSGMSST+ESFSGP+ +PP T RR PRSPP+LP Sbjct: 156 AQRPTSSGMSSTVESFSGPRPAPANLPPATLRRHPRSPPLLP 197 >ref|XP_002278022.1| PREDICTED: ethylene-responsive transcription factor 3-like [Vitis vinifera] Length = 224 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +2 Query: 50 AQRPASSGMSSTLESFSGPK--STIVPPITSRRFPRSPPILP 169 AQRP SSGMSST+ESFSGP+ +PP T RR PRSPP+LP Sbjct: 128 AQRPTSSGMSSTVESFSGPRPAPANLPPATLRRHPRSPPLLP 169 >dbj|BAL68169.1| ethylene response factor #205 [Nicotiana tabacum] Length = 227 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = +2 Query: 5 PFLDPRFFNPNLIASAQRPASSGMSSTLESFSGPKSTIVP----PITSRRFPRSPPILP 169 PF+D RF+ + +QRP SS MSST+ESFS P+ P +SR++PRSPP+LP Sbjct: 105 PFVDSRFYPQDNPIISQRPTSSSMSSTVESFSRPRPPPAPRQQTTASSRKYPRSPPVLP 163