BLASTX nr result
ID: Angelica22_contig00005945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00005945 (833 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547014.1| PREDICTED: scarecrow-like protein 14-like [G... 66 1e-08 ref|XP_003542036.1| PREDICTED: scarecrow-like protein 14-like [G... 66 1e-08 dbj|BAC77269.2| SCARECROW-like protein [Lilium longiflorum] 65 2e-08 ref|XP_002533753.1| transcription factor, putative [Ricinus comm... 65 2e-08 ref|XP_002314172.1| GRAS family transcription factor [Populus tr... 65 2e-08 >ref|XP_003547014.1| PREDICTED: scarecrow-like protein 14-like [Glycine max] Length = 727 Score = 65.9 bits (159), Expect = 1e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 46 KVRSEYHKDFVFDDDGQWLVVGWKGRILYATSAWVPA 156 K+R YH+DFVFD+DG W++ GWKGRILYA++ WVPA Sbjct: 691 KLREWYHRDFVFDEDGNWMLQGWKGRILYASTCWVPA 727 >ref|XP_003542036.1| PREDICTED: scarecrow-like protein 14-like [Glycine max] Length = 723 Score = 65.9 bits (159), Expect = 1e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 46 KVRSEYHKDFVFDDDGQWLVVGWKGRILYATSAWVPA 156 K+R YH+DFVFD+DG W++ GWKGRILYA++ WVPA Sbjct: 687 KLREWYHRDFVFDEDGNWMLQGWKGRILYASTCWVPA 723 >dbj|BAC77269.2| SCARECROW-like protein [Lilium longiflorum] Length = 748 Score = 64.7 bits (156), Expect = 2e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 46 KVRSEYHKDFVFDDDGQWLVVGWKGRILYATSAWVP 153 KV+ YHKDFV D+DG+WL++GWKGRI+YA SAW P Sbjct: 710 KVKELYHKDFVVDEDGRWLLLGWKGRIIYALSAWTP 745 >ref|XP_002533753.1| transcription factor, putative [Ricinus communis] gi|223526341|gb|EEF28640.1| transcription factor, putative [Ricinus communis] Length = 764 Score = 64.7 bits (156), Expect = 2e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 46 KVRSEYHKDFVFDDDGQWLVVGWKGRILYATSAWVPA 156 +V+ YH DFV D DGQW++ GWKGRI+YA+SAWVPA Sbjct: 728 RVKEGYHNDFVVDQDGQWMLQGWKGRIIYASSAWVPA 764 >ref|XP_002314172.1| GRAS family transcription factor [Populus trichocarpa] gi|222850580|gb|EEE88127.1| GRAS family transcription factor [Populus trichocarpa] Length = 762 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = +1 Query: 46 KVRSEYHKDFVFDDDGQWLVVGWKGRILYATSAWVPA 156 KV++ YH+DFV D+DG W++ GWKGRI+YA+SAW+PA Sbjct: 726 KVKAGYHEDFVVDEDGNWMLQGWKGRIVYASSAWIPA 762