BLASTX nr result
ID: Angelica22_contig00005401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00005401 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF75651.1| transcription factor DcERF1 [Daucus carota] 100 2e-19 sp|Q40478.1|ERF5_TOBAC RecName: Full=Ethylene-responsive transcr... 58 9e-07 gb|AAX20037.1| ethylene responsive element binding protein C4 [C... 56 3e-06 gb|ADP37427.1| ethylene-responsive-element-binding factor 12 [Pe... 56 3e-06 >dbj|BAF75651.1| transcription factor DcERF1 [Daucus carota] Length = 296 Score = 99.8 bits (247), Expect = 2e-19 Identities = 45/52 (86%), Positives = 50/52 (96%), Gaps = 1/52 (1%) Frame = -1 Query: 283 CPLTPSIWTEVWEGGDDKGGIFEIPPLSPLSPYLNFTQINANDVKK-QLAQQ 131 CPLTPS+WTEVWEGG++KGGIFEIPPLSPLSPYLNFTQ+NA DVKK Q+AQQ Sbjct: 245 CPLTPSMWTEVWEGGEEKGGIFEIPPLSPLSPYLNFTQLNAGDVKKQQVAQQ 296 >sp|Q40478.1|ERF5_TOBAC RecName: Full=Ethylene-responsive transcription factor 5; AltName: Full=Ethylene-responsive element-binding factor 4; Short=EREBP-4; AltName: Full=Ethylene-responsive element-binding factor 5 homolog; AltName: Full=NtERF4 gi|1208497|dbj|BAA07323.1| ethylene-responsive element binding protein [Nicotiana tabacum] Length = 291 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -1 Query: 280 PLTPSIWTEVWEGGDDKGGIFEIPPLSPLSPYLNFTQI 167 PLTPS W+ +WEG D KG IFE+PPLSPLSP++ ++Q+ Sbjct: 252 PLTPSSWSAIWEGEDGKG-IFEVPPLSPLSPHMAYSQL 288 >gb|AAX20037.1| ethylene responsive element binding protein C4 [Capsicum annuum] Length = 272 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/38 (57%), Positives = 33/38 (86%) Frame = -1 Query: 280 PLTPSIWTEVWEGGDDKGGIFEIPPLSPLSPYLNFTQI 167 PLTPS W+ +W+ G+ KG IFE+PPLSPLSP+++++Q+ Sbjct: 233 PLTPSNWSTIWDSGNGKG-IFEVPPLSPLSPHMSYSQL 269 >gb|ADP37427.1| ethylene-responsive-element-binding factor 12 [Petunia x hybrida] Length = 289 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -1 Query: 280 PLTPSIWTEVWEGGDDKGGIFEIPPLSPLSPYLNF 176 PLTPS W+ +W+ GD KG IFE+PPLSPLSPY +F Sbjct: 248 PLTPSSWSSIWDCGDGKG-IFEVPPLSPLSPYSSF 281