BLASTX nr result
ID: Angelica22_contig00004999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00004999 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520135.1| voltage-dependent anion-selective channel, p... 75 4e-12 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membra... 74 1e-11 ref|XP_002873707.1| voltage-dependent anion-selective channel pr... 74 1e-11 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] 74 1e-11 ref|XP_002312708.1| porin/voltage-dependent anion-selective chan... 74 1e-11 >ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus communis] gi|223540627|gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus communis] Length = 276 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 317 GIASALIQHAWRPKSLVTISGEVDTRAIEKSAKVGIALALKP 192 G ASALIQH WRPKSL TISGEVDTRAIEKSAK+G+ALALKP Sbjct: 235 GKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC gi|515360|emb|CAA56600.1| 36kDA porin II [Solanum tuberosum] Length = 276 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 317 GIASALIQHAWRPKSLVTISGEVDTRAIEKSAKVGIALALKP 192 G ASALIQH WRPKSL TISGEVDTRAIEKSAK+G+A+ALKP Sbjct: 235 GKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis lyrata subsp. lyrata] gi|297319544|gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis lyrata subsp. lyrata] Length = 276 Score = 74.3 bits (181), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 317 GIASALIQHAWRPKSLVTISGEVDTRAIEKSAKVGIALALKP 192 G+A+ALIQH WRPKS T+SGEVD+RAIEKSAKVGIALALKP Sbjct: 235 GVANALIQHEWRPKSFFTVSGEVDSRAIEKSAKVGIALALKP 276 >dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] Length = 276 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 317 GIASALIQHAWRPKSLVTISGEVDTRAIEKSAKVGIALALKP 192 G ASALIQH WRPKSL TISGEVDTRAIEKSAK+G+A+ALKP Sbjct: 235 GKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_002312708.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] gi|118484777|gb|ABK94257.1| unknown [Populus trichocarpa] gi|222852528|gb|EEE90075.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] Length = 276 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 317 GIASALIQHAWRPKSLVTISGEVDTRAIEKSAKVGIALALKP 192 G ASALIQH WRPKSL TISGEVDT+AIEKSAK+G+ALALKP Sbjct: 235 GKASALIQHEWRPKSLFTISGEVDTKAIEKSAKIGLALALKP 276