BLASTX nr result
ID: Angelica22_contig00004852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00004852 (750 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510344.1| conserved hypothetical protein [Ricinus comm... 66 7e-09 >ref|XP_002510344.1| conserved hypothetical protein [Ricinus communis] gi|223551045|gb|EEF52531.1| conserved hypothetical protein [Ricinus communis] Length = 388 Score = 66.2 bits (160), Expect = 7e-09 Identities = 48/133 (36%), Positives = 73/133 (54%), Gaps = 10/133 (7%) Frame = -1 Query: 750 RGDFLELVDLADPQXXXXXXXXXSCPTLASEELFDSEMLLQELEDKR----LDRKEQFKY 583 RGD+LEL+DL +P SC T++S+E FDS LL+EL+ + + + E K+ Sbjct: 218 RGDYLELLDLDNPASPSSSSDNSSCLTMSSDEYFDSLALLRELDSESNQDLVQKNENCKF 277 Query: 582 TVSGTVKSNEVVMHPAI-VGKLTTQEP-----LKSNCSVPALVVRGENDGLVLECKQETE 421 ++S + K NEV+M PA VG L++ E L + S+PALV EN +++ + + Sbjct: 278 SISVSFKPNEVLMVPASPVGSLSSNEESRQGILGTGLSLPALVDDNEN---LVDVVRSQK 334 Query: 420 VVYASENASASSD 382 Y E S S D Sbjct: 335 ADYRDEGPSNSHD 347