BLASTX nr result
ID: Angelica22_contig00003645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00003645 (551 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 119 3e-25 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 112 3e-23 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 112 4e-23 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 112 5e-23 ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 111 9e-23 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 119 bits (298), Expect = 3e-25 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = +1 Query: 127 MSTCGNCDCSDKSQCVKKGTGYGLDIVETGKSFVQTTVMEVSGTENDGKCKCGTSCTCVN 306 MSTCGNCDC+DKSQCVKKG GY ++I+ET KSF + TV EV E+DGKCKCG+SCTCV+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAAEHDGKCKCGSSCTCVD 60 Query: 307 CTCGGH 324 CTCGGH Sbjct: 61 CTCGGH 66 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 112 bits (281), Expect = 3e-23 Identities = 48/63 (76%), Positives = 51/63 (80%) Frame = +1 Query: 130 STCGNCDCSDKSQCVKKGTGYGLDIVETGKSFVQTTVMEVSGTENDGKCKCGTSCTCVNC 309 STCGNCDC+DKSQCVKKG+ Y DIVET KSFV T VMEV TE DGKC+CG CTC NC Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPATEPDGKCRCGAGCTCTNC 62 Query: 310 TCG 318 TCG Sbjct: 63 TCG 65 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 112 bits (280), Expect = 4e-23 Identities = 48/63 (76%), Positives = 52/63 (82%) Frame = +1 Query: 130 STCGNCDCSDKSQCVKKGTGYGLDIVETGKSFVQTTVMEVSGTENDGKCKCGTSCTCVNC 309 STCGNCDC+DKSQCVKKG+ Y D+VET KS V T VMEV E+DGKCKCG SCTCVNC Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVPAAEHDGKCKCGASCTCVNC 62 Query: 310 TCG 318 TCG Sbjct: 63 TCG 65 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 112 bits (279), Expect = 5e-23 Identities = 47/63 (74%), Positives = 52/63 (82%) Frame = +1 Query: 130 STCGNCDCSDKSQCVKKGTGYGLDIVETGKSFVQTTVMEVSGTENDGKCKCGTSCTCVNC 309 STCGNCDC+DKSQCVKKG+ Y DIVET KSFV T +M+V E+DGKCKCG SCTCV C Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAEHDGKCKCGASCTCVTC 62 Query: 310 TCG 318 TCG Sbjct: 63 TCG 65 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 111 bits (277), Expect = 9e-23 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = +1 Query: 127 MSTCGNCDCSDKSQCVKKGTGYGLDIVETGKSFVQTTVMEVSGTENDGKCKCGTSCTCVN 306 MSTCGNCDC+DKSQCVKKG YG+DIVET KS+V T VMEV +++G CKCG SC C++ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHEGSCKCGDSCACID 60 Query: 307 CTCG 318 CTCG Sbjct: 61 CTCG 64