BLASTX nr result
ID: Angelica22_contig00003470
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00003470 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP49327.1| H/ACA ribonucleoprotein complex subunit, partial ... 91 1e-16 ref|XP_002269703.1| PREDICTED: H/ACA ribonucleoprotein complex s... 88 8e-16 ref|XP_002311407.1| predicted protein [Populus trichocarpa] gi|1... 87 2e-15 ref|XP_004137455.1| PREDICTED: H/ACA ribonucleoprotein complex s... 83 2e-14 dbj|BAJ53160.1| JHL10I11.6 [Jatropha curcas] 83 3e-14 >gb|AFP49327.1| H/ACA ribonucleoprotein complex subunit, partial [Olea europaea] Length = 92 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -1 Query: 279 ELANAGSTKRPTCCVLVLTKPTKGELAQDELEKLKSDYDLVVSDVSELASTLF 121 +LANAG+TKRPTCCVLVLTKPTKGE+AQDE EKLK DYD V S+VSELA+++F Sbjct: 40 DLANAGATKRPTCCVLVLTKPTKGEIAQDEQEKLKGDYDQVASEVSELANSMF 92 >ref|XP_002269703.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 2-like protein [Vitis vinifera] gi|147867156|emb|CAN80504.1| hypothetical protein VITISV_035185 [Vitis vinifera] gi|297734127|emb|CBI15374.3| unnamed protein product [Vitis vinifera] Length = 157 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 279 ELANAGSTKRPTCCVLVLTKPTKGELAQDELEKLKSDYDLVVSDVSELASTLF 121 +LANAGSTKRPTCCVLVLTKPTKGEL Q+E EKLK++Y VVSDVS L STLF Sbjct: 105 DLANAGSTKRPTCCVLVLTKPTKGELGQEEQEKLKAEYTQVVSDVSGLTSTLF 157 >ref|XP_002311407.1| predicted protein [Populus trichocarpa] gi|118483385|gb|ABK93593.1| unknown [Populus trichocarpa] gi|118485555|gb|ABK94629.1| unknown [Populus trichocarpa] gi|222851227|gb|EEE88774.1| predicted protein [Populus trichocarpa] Length = 155 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -1 Query: 279 ELANAGSTKRPTCCVLVLTKPTKGELAQDELEKLKSDYDLVVSDVSELASTLF 121 +LA+AG+TKRPTCCVLVLTKPTKGE+ +++ EKLK+DYD VVSDVSEL S+LF Sbjct: 103 DLASAGATKRPTCCVLVLTKPTKGEIGKEDQEKLKADYDQVVSDVSELTSSLF 155 >ref|XP_004137455.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 2-like protein-like [Cucumis sativus] gi|449486884|ref|XP_004157431.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 2-like protein-like [Cucumis sativus] Length = 158 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 279 ELANAGSTKRPTCCVLVLTKPTKGELAQDELEKLKSDYDLVVSDVSELASTLF 121 +LANAGSTKRPTCCVLV TKP KGEL E EKLK+D+D VV++VSEL STLF Sbjct: 106 DLANAGSTKRPTCCVLVQTKPNKGELGSTEQEKLKADFDQVVAEVSELTSTLF 158 >dbj|BAJ53160.1| JHL10I11.6 [Jatropha curcas] Length = 155 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = -1 Query: 279 ELANAGSTKRPTCCVLVLTKPTKGELAQDELEKLKSDYDLVVSDVSELASTLF 121 +LANAG+TKRPTCCVLVLTKP KG++ Q+E EKLK+D+ VV+DVSEL S+LF Sbjct: 103 DLANAGATKRPTCCVLVLTKPPKGDIGQEEQEKLKADFSQVVADVSELTSSLF 155