BLASTX nr result
ID: Angelica22_contig00002547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00002547 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL76932.1|AF456481_1 major allergen isoform Dau c 1.0201 [Da... 67 2e-09 sp|P92918.1|ALL2_APIGR RecName: Full=Major allergen Api g 2; Alt... 67 2e-09 >gb|AAL76932.1|AF456481_1 major allergen isoform Dau c 1.0201 [Daucus carota] Length = 154 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +2 Query: 2 NTKGDAVLPEDKVKEATEKSALAFKAVEAYLLSN 103 NTKGDAVLPEDKVKEATEKSALAFKAVEAYLL+N Sbjct: 121 NTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154 >sp|P92918.1|ALL2_APIGR RecName: Full=Major allergen Api g 2; AltName: Full=Allergen Api g 1.0201; AltName: Allergen=Api g 2 gi|1769847|emb|CAA99992.1| Api g 1.0201 allergen [Apium graveolens] Length = 159 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 2 NTKGDAVLPEDKVKEATEKSALAFKAVEAYLLSN 103 NTKGDAVLPEDK+KEATEKSALAFKAVEAYLL+N Sbjct: 121 NTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154