BLASTX nr result
ID: Angelica22_contig00002223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00002223 (525 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30940.3| unnamed protein product [Vitis vinifera] 55 5e-06 >emb|CBI30940.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 3/37 (8%) Frame = +3 Query: 3 EFHKFYKNLSVGLKDIVWKSGEDAKELT---QGVAST 104 EFHKFYKNLS GLKDIVWKSG+++KE GVAST Sbjct: 419 EFHKFYKNLSTGLKDIVWKSGDESKEEVNNGSGVAST 455