BLASTX nr result
ID: Angelica22_contig00002001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00002001 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 74 2e-11 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 73 3e-11 gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 72 4e-11 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 70 1e-10 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 448 SSCGNCDCADKTQCVKKGNSYGIDMVETEKSSVKTMVMNM 329 S+CGNCDCADK+QCVKKGNSYGID+VETEKS V T+VM + Sbjct: 2 STCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEV 41 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -2 Query: 454 MSSSCGNCDCADKTQCVKKGNSYGIDMVETEKSSVKTMVMNM 329 MSS+CGNCDCADK+QCVKKG+SY D+VETEKSSV T+VM + Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEV 42 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/49 (69%), Positives = 42/49 (85%), Gaps = 3/49 (6%) Frame = -2 Query: 454 MSSSCGNCDCADKTQCVKKGNSYGIDMVETEKSSVKTMVMNM---SEND 317 MSS+CGNCDCADK+QCVKKG+SY D+VETEKS V T+VM++ +END Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAEND 49 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 454 MSSSCGNCDCADKTQCVKKGNSYGIDMVETEKSSVKTMVMNM 329 MSS+CGNCDCADK+QCVKKG+SY D+VETEKS V T+VM + Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEV 42 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -2 Query: 454 MSSSCGNCDCADKTQCVKKGNSYGIDMVETEKSSVKTMVMNM 329 MSS+CGNCDCADK+QCVKKG+SY D+VETEKS V T++M++ Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDV 42