BLASTX nr result
ID: Angelica22_contig00001468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00001468 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_01682799.1| fatty oxidation complex alpha subunit [Vibrio... 60 1e-07 emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] 56 3e-06 >ref|ZP_01682799.1| fatty oxidation complex alpha subunit [Vibrio cholerae V52] gi|121627762|gb|EAX60388.1| fatty oxidation complex alpha subunit [Vibrio cholerae V52] Length = 275 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +1 Query: 1 DMYEMGQKMLEKFDKYWGDPRKMNTFLFISVVLDPRHKLQFLVYMLKDMYGGEVG 165 D+ +M M EKF KYWG P KMN LFI+ VLDPR+K ++ + L+++ G E G Sbjct: 50 DLSKMASGMKEKFKKYWGTPEKMNKMLFIASVLDPRNKFVYVNFALEELLGEEKG 104 >emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] Length = 563 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = +1 Query: 10 EMGQKMLEKFDKYWGDPRKMNTFLFISVVLDPRHKLQFLVYMLKDMYGGEV 162 +M Q M K+DKYWG+ ++ N L++ VVLDPR+KL+F+ + +Y EV Sbjct: 328 DMAQNMKAKYDKYWGNLKRSNLLLYVVVVLDPRYKLKFVQFCFDQLYDKEV 378