BLASTX nr result
ID: Angelica22_contig00001288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00001288 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272447.2| PREDICTED: alpha-1,4-galacturonosyltransfera... 83 3e-14 emb|CBI38820.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|XP_002511763.1| transferase, transferring glycosyl groups, p... 82 3e-14 emb|CAB81547.1| 68 kDa protein [Cicer arietinum] 81 8e-14 tpg|DAA62449.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea m... 81 8e-14 >ref|XP_002272447.2| PREDICTED: alpha-1,4-galacturonosyltransferase 1-like [Vitis vinifera] Length = 654 Score = 82.8 bits (203), Expect = 3e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 HYNGNMKPWLELAMRKYRSYWSKYIKFDHPYIRDCKLSE 119 HYNGNMKPWLELAM KYRSYW+KYIK+DHPY+R C LSE Sbjct: 616 HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSCNLSE 654 >emb|CBI38820.3| unnamed protein product [Vitis vinifera] Length = 681 Score = 82.8 bits (203), Expect = 3e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 HYNGNMKPWLELAMRKYRSYWSKYIKFDHPYIRDCKLSE 119 HYNGNMKPWLELAM KYRSYW+KYIK+DHPY+R C LSE Sbjct: 643 HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSCNLSE 681 >ref|XP_002511763.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223548943|gb|EEF50432.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 710 Score = 82.4 bits (202), Expect = 3e-14 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 HYNGNMKPWLELAMRKYRSYWSKYIKFDHPYIRDCKLSE 119 HYNGNMKPWLE+AM KYRSYW+KYIK+DHPY+R+C LSE Sbjct: 672 HYNGNMKPWLEIAMTKYRSYWTKYIKYDHPYLRNCNLSE 710 >emb|CAB81547.1| 68 kDa protein [Cicer arietinum] Length = 591 Score = 81.3 bits (199), Expect = 8e-14 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 3 HYNGNMKPWLELAMRKYRSYWSKYIKFDHPYIRDCKLSE 119 HYNGNMKPWLE+AM KYR YWSKY+K++HPY+R+CKLSE Sbjct: 551 HYNGNMKPWLEIAMTKYRPYWSKYVKYNHPYLRNCKLSE 589 >tpg|DAA62449.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea mays] Length = 683 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 HYNGNMKPWLELAMRKYRSYWSKYIKFDHPYIRDCKLSE 119 HYNGNMKPWLELAM KYR YW+KYIK+DHPYIR C LSE Sbjct: 645 HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGCNLSE 683